KEGG   Cupriavidus basilensis: RR42_s2821Help
Entry
RR42_s2821        CDS       T03642                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00010  Glycolysis / Gluconeogenesis
cbw00620  Pyruvate metabolism
cbw01100  Metabolic pathways
cbw01110  Biosynthesis of secondary metabolites
cbw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RR42_s2821
   00620 Pyruvate metabolism
    RR42_s2821
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RR42_s2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJG24402
UniProt: A0A0C4YF50
LinkDB All DBs
Position
secondary:3113161..3114681
Genome map
AA seq 506 aa AA seqDB search
MNMAEIAQLGVAYPYKEQYENYIGGAWLAPADGQYFEAISPVTGKPFTRVPRSNQKDVDA
ALDAAHRAKGAWGRTSTTERANILNRIADRIEANLVTLAVAETIDNGKPIRETTAADLPL
AVDHFRYFAGCIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVLNVINGFGLEAGKPLASSSRISKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLSADDAYFDKALEGFAMFALNQGEV
CTCPSRALIQESIYERFMERALKRVAAIKQGHPLDKATMIGAQASQEQLEKILSYIDLGK
QEGAQCLIGGERNALGGDLASGYYVKPTVFSGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
EIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcggaaatcgcccagctgggcgttgcgtatccctacaaggaacagtacgaa
aactatatcggcggcgcctggctggccccggccgatggccagtactttgaagcgatctcg
ccggtcaccggcaagcccttcacgcgcgtgccgcgctccaaccagaaggacgtggacgcc
gcgctggacgccgcgcaccgcgccaagggcgcctggggccgcacctccaccaccgaacgc
gccaacatcctgaaccgcatcgctgaccgcatcgaggccaacctggtcacgctggcggtg
gccgaaaccatcgacaacggcaagcccatccgcgaaaccacggcggccgacctgccgctg
gcggtggaccatttccgctacttcgccggctgcatccgcgcgcaggaaggcggcatttcc
gagatcgaccacgacaccgtggcctatcacttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctcctgatggccacgtggaagctcgcgcccgcgctggcc
gccggcaactgtgtggtgctcaagcccgcggagcagacgccggcctcgatcctggtgctg
atggaaatcatcggcgacctgctgccgccgggcgtgctcaatgtgatcaacggcttcggg
ctcgaggcaggcaagccgctggcctccagttcgcgcatcagcaagatcgcctttaccggt
gagaccaccaccggccggctgatcatgcagtacgcctcgcagaacctgatcccggtcacg
ctggaactgggtggcaagtcgcccaacatcttcttcgaggacgtgctgtccgccgacgac
gcctacttcgacaaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctgatccaggagtcgatctacgagcgcttcatggagcgc
gcgctcaagcgcgtggcagcgatcaagcaaggccacccgctcgacaaggccaccatgatc
ggcgcgcaggcttctcaggagcagcttgagaagatcctgtcgtatatcgacctgggcaag
caggaaggcgcgcaatgcctgatcggcggcgagcgcaacgcgctgggtggcgaccttgcg
agcggctactacgtcaagcccacggtgttctcgggccataacaagatgcgcattttccag
gaagagatctttggcccggtggtgtcggtgaccacgttcaaggatgaggaagaagcgctg
gaaatcgccaacgacacgctctacgggctaggcgccggcgtatggacgcgagacggcgca
cgcgccttccgcatgggccgcggcatccaggccggccgcgtgtggaccaactgctatcac
gcctacccggcgcatgcggcgtttggcggctacaagcaatccggcatcgggcgcgagaac
catcgcatgatgctggaccactaccagcagaccaagaacctgctggtgagctacagcccg
aacgcgctcggcttcttttga

DBGET integrated database retrieval system