KEGG   Candidatus Symbiobacter mobilis: Cenrod_0223Help
Entry
Cenrod_0223       CDS       T02877                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cbx  Candidatus Symbiobacter mobilis
Brite
KEGG Orthology (KO) [BR:cbx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cenrod_0223 (ahpF)
Enzymes [BR:cbx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Cenrod_0223 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored DAO Thi4 HI0933_like NAD_binding_7 FAD_binding_2 AlaDh_PNT_C NAD_binding_8 FAD_binding_3 Trp_halogenase FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGX86351
UniProt: U5N4G8
LinkDB All DBs
Position
complement(229070..230623)
Genome map
AA seq 517 aa AA seqDB search
MLDETLSLQLQSHLTRMREPVGLVASLDDSAASRDLQQLLEQISQLTDKIAVSMAGTDVR
RPSFQVRRAQAGGSLTFAAIPLGHEFTSLVLALLWAGGHPPKVEPEVLRRIEAIDRILHF
EVYVSLSCHNCPDVVQALSLMALRNPRISATVIDGALFPQEAEQREVMAVPTVLLDGEPF
STGRISLEEILEKLAPGLREQAAAEWAKAAPFDVLVVGGGPAGAAAAVYAARKGIRTAVV
AERFGGQVNDTVAIENFVSVLETDGAKFAAALEAHVRAYEVPILHMQRVERLLAPEQDKG
LIEVGLSSGTTLRSRTVILCPGARWRNVNVPGEQKYRNKGVAYCPHCDGPLFRGKRVAVI
GGGNSGVEAAIDLAGITAHVTLIEFDTRLRADAVLVQKLQSLPNVAILTHAQTTEITGDG
SKVNGLSYLDRSTQETQHVPLEGVFVQIGLVPNTDWLRGTLELSRTGEIVVDTRGQTSLA
GVFAAGDASTSPFKQIIIATGDGAKAALSAFDYLVRM
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgaaaccctatccctccaactccagtcccacctgacgcgcatgcgcgagcca
gtgggactggtagcgagtctggacgactcggctgcctcccgcgatctgcaacagttgcta
gagcaaatctcgcaattgacggacaagatcgccgtctccatggcaggaactgatgtgcgc
cgcccctcttttcaagtacgccgcgcccaggctgggggttcgctgactttcgcggccatt
ccgctggggcacgagttcacctcgctggtgcttgcgctgctgtgggcgggtgggcatccg
cccaaggtcgagccggaagtgctgcgcaggatcgaagccatcgaccggatcctgcacttc
gaggtgtacgtctcgctctcctgccacaactgccccgacgtggtgcaagcgctgagcctg
atggccttgcgcaacccgcgtatttcggcaacggtgatcgacggcgcgctgttcccgcaa
gaagccgagcagcgcgaagtgatggcggtgcccacggtcttgttggacggggaaccgttt
tccacaggaaggatttcgctcgaagaaatcctcgaaaaattggcgcccgggctgcgcgaa
caggctgctgcggaatgggccaaggccgcgccgttcgacgtgctcgtggtggggggcggc
cccgcaggcgctgccgctgccgtctacgccgcacgcaagggcattcgcaccgccgtcgtc
gcagagcgtttcggcgggcaggtcaacgatacggtcgccatcgaaaacttcgtttccgta
ttggaaaccgacggcgccaagtttgctgcggcgctagaagcgcacgtgcgtgcttacgag
gtgccgatcttgcacatgcagcgggtggaacggctcctcgccccggaacaggacaagggc
ttgattgaggtgggcctctccagcggcacgaccttgcgctcccgcaccgtcatcctctgc
cccggcgcacgctggcgcaacgtcaatgttccgggcgaacagaagtaccgcaacaaaggg
gtggcctattgcccccactgcgacggcccgctctttcggggcaagcgcgtcgcggtcatc
ggtgggggcaactcgggggtcgaagccgccatcgaccttgccggtatcaccgcgcacgtc
acgctgatcgaattcgatacccgactccgggcagacgccgtgctcgtgcagaaactccag
agcctgcccaacgtggcgatactgacccacgcgcaaaccaccgaaatcaccggggacggc
agcaaagtcaacggcctgagctatctcgatcgcagcacgcaggaaacacaacacgtccca
ctggaaggtgtcttcgtgcagatcgggctggtgccaaacaccgactggctacggggaacc
ctcgaactcagccgcacaggggaaatcgtggtcgacacacgcggccagacttcccttgcc
ggtgtgttcgccgccggggatgccagcacctcccccttcaagcagatcatcatcgccacc
ggagacggcgccaaggcagcgctcagcgcgttcgactacctggtgaggatgtag

DBGET integrated database retrieval system