KEGG   Clostridium botulinum A2: CLM_2134Help
Entry
CLM_2134          CDS       T00883                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cby  Clostridium botulinum A2
Pathway
cby00250  Alanine, aspartate and glutamate metabolism
cby00410  beta-Alanine metabolism
cby00430  Taurine and hypotaurine metabolism
cby00650  Butanoate metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLM_2134
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLM_2134
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLM_2134
   00430 Taurine and hypotaurine metabolism
    CLM_2134
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLM_2134
Enzymes [BR:cby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CLM_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACO85906
UniProt: C1FPE4
LinkDB All DBs
Position
2183364..2184767
Genome map
AA seq 467 aa AA seqDB search
MLYSSKNKQSNDTYATPIFGITKDKYSIPKYKINENSIAPNIAYRMIKDELMNEGNARLN
LATFCQTYMEDKATKLMAETLQKNAIDKSEYPQTAEIENRCVNIISDLWNVPKDMNFLGT
STVGSSEACMLGGMSMKFRWRDQAKKLGIDINKKKPNLVISSGYQVCWEKFCVYWDIEMR
TVPMDEDNLSLNIDKILDYVDEYTIGIIGILGITYTGKFDDIKALDDAIEKYNSNHDIKV
YIHVDAASGGFFTPFINPEILWDFRLKNVVSINASGHKYGLVYPGIGWILWKDQEYLPKD
LIFEVSYLGGKMPTLAINFSRSGSQIIGQYYNFLRFGFEGYKKIHERTKEVAMYISKELE
ATGLFSIYNDGSNLPIVCYKLKEQSKVKWNLYDLSDRLAMKGWQIPAYPLPENLNHIIIQ
RIVCRSDLGYNLAELLIKDFKTAINDLNNAHILFHEEENQGIYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctctattcttcaaaaaacaagcaaagtaatgatacctatgctacccctatttttggt
atcactaaggacaagtattcaattcctaagtacaaaattaatgaaaattctattgcacct
aatatagcctatcgtatgattaaagatgaacttatgaatgaaggtaacgcacgcttaaat
ttagctactttttgtcagacctatatggaagataaagctaccaaacttatggctgaaacc
ttacaaaaaaatgctatcgacaagtctgaatatccacaaactgccgaaatagagaatcgc
tgtgttaatattatttcagatctttggaatgtcccaaaggatatgaacttcttaggtacc
tctactgtgggttcttcagaagcttgtatgttaggtggcatgtctatgaaattccgttgg
cgtgatcaggctaaaaaattaggtattgatattaacaagaagaaacctaacttggtaata
tcatctggttatcaggtatgttgggaaaaattctgtgtatattgggatattgaaatgcgt
accgttcctatggatgaggataatctaagtttaaatatagataagattcttgattatgta
gatgaatatactataggaattataggtattttaggtataacttatacgggtaaatttgat
gatattaaagcattagatgatgccattgaaaaatataatagtaatcatgatataaaggta
tatattcatgtagatgctgcctctggtggctttttcaccccatttattaatccagaaatt
ttgtgggattttcgtctaaaaaatgtagtttctataaatgcatccggtcataaatatgga
ttagtgtatccaggaataggttggattctgtggaaggatcaagaatatcttcctaaagat
ttaatatttgaagtaagttatttgggtggcaaaatgccaaccttagctattaatttttct
agatctggaagtcaaatcataggacaatattataatttcctacgctttggttttgaagga
tataaaaaaattcatgaacgcacaaaagaggtagctatgtatatttcaaaagagcttgaa
gctacaggattattcagtatatataatgatggcagtaatcttcctatagtttgttataaa
ctaaaggaacaatctaaggtaaaatggaatctttatgatttatcagatagactagctatg
aaaggctggcaaataccagcttaccctctccctgaaaatcttaaccatataataatacaa
agaatagtttgtcgttcagacctaggatataatttagcagaactattgataaaagatttt
aaaacagcaataaatgatttgaataatgctcatatattatttcatgaagaagaaaaccaa
ggtatttatggatttactcattaa

DBGET integrated database retrieval system