KEGG   Clostridium botulinum A2: CLM_2584Help
Entry
CLM_2584          CDS       T00883                                 

Gene name
sodF
Definition
(GenBank) Mn/Fe superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cby  Clostridium botulinum A2
Brite
Enzymes [BR:cby01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLM_2584 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACO85273
UniProt: C1FRT5
LinkDB All DBs
Position
complement(2616806..2617402)
Genome map
AA seq 198 aa AA seqDB search
MAHTLPNLNYDYNALEPHYDEQTLKIHHDIHHKAYVDGLNKAEQKLQEARESGDFALIKH
WEKEIAFHGSGHILHTLFWENMVPNGNLNPEGSAIERIKQDFGDYEKFKKQFTEAAIAVE
GSGWTILAWNPMFQKLVILQAEKHQNLTQWGVVPLLILDLWEHAYYLKYQNRRAEFINAW
WNIVNWDIVNTRYDNAIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcacatactttaccaaatttaaattatgattacaatgcattagaacctcattatgat
gagcagactttgaaaatacatcatgatattcatcataaagcttatgtagatggattgaat
aaagcggaacaaaagcttcaagaagctagagaatcaggagattttgcattaataaagcat
tgggaaaaggaaatagcatttcatgggtcaggtcacattttacatacattattttgggaa
aatatggtccctaatggaaatctaaatcctgagggatctgcaattgaaagaataaaacaa
gattttggagattatgaaaaatttaaaaaacaatttacggaagctgctatagcagtagaa
ggttcaggctggactattttagcatggaatcctatgtttcaaaaattagtaatattgcag
gcagaaaaacatcaaaatttaactcaatggggagtagttccactattaattttagattta
tgggaacatgcatattatttaaaatatcaaaatagaagggcagagtttattaatgcttgg
tggaatattgtaaattgggatatagtaaatactagatatgataatgctataaaataa

DBGET integrated database retrieval system