KEGG   Clostridium botulinum A2: CLM_3835Help
Entry
CLM_3835          CDS       T00883                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cby  Clostridium botulinum A2
Pathway
cby00010  Glycolysis / Gluconeogenesis
cby00030  Pentose phosphate pathway
cby00051  Fructose and mannose metabolism
cby00052  Galactose metabolism
cby00680  Methane metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby01130  Biosynthesis of antibiotics
cby01200  Carbon metabolism
cby01230  Biosynthesis of amino acids
cby03018  RNA degradation
Module
cby_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_3835 (pfkA)
   00030 Pentose phosphate pathway
    CLM_3835 (pfkA)
   00051 Fructose and mannose metabolism
    CLM_3835 (pfkA)
   00052 Galactose metabolism
    CLM_3835 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CLM_3835 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CLM_3835 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cby01009]
    CLM_3835 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cby03019]
    CLM_3835 (pfkA)
Enzymes [BR:cby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLM_3835 (pfkA)
Protein phosphatases and associated proteins [BR:cby01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLM_3835 (pfkA)
Messenger RNA biogenesis [BR:cby03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLM_3835 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACO86187
UniProt: C1FM55
LinkDB All DBs
Position
complement(3874139..3875098)
Genome map
AA seq 319 aa AA seqDB search
MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDI
IQRGGTILRTARCEEFRTEQGREKAAKILKAFGIDGLVVIGGDGSFHGAQLLSKLGINTV
GLPGTIDNDLAYTDYTIGFDTSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYT
GVAGGAESIIIPEKEYNADKLCKQILQGKLKGKMHNLVLLAEGVGGANELAKYIEEVTGI
ETRSTILGHIQRGGSPTCMDRILASRMAYKAVELLISGKSSRVVGIKNGKIIDMDIDEAL
AVERSFDQELYDIATILSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatagctgtattaacaagtggtggagatgcaccaggaatgaatgctgctatc
agagcagtagttagaacaggtttagaaaaaggtttaaaagtaatgggaattcaaagagga
tataacggacttataaatggagaaatatttgaaatggatactcatagcgtatctgatata
atacaaagaggcggaactatattaagaacagctcgttgtgaagagtttagaacagagcag
ggaagagaaaaagctgctaaaatattaaaagcctttggtattgatggattagttgtaatt
ggtggagacggttcttttcatggggcccaattattatctaagttaggaataaatactgtt
ggactaccaggtactatagataatgatttagcttatacagactatacaattggctttgat
acatctataaatacagttttagatgctataaataagcttagagatacatccacttctcat
gaaagagtaagtgtagtagaagttatgggaagaaattgtggagatatagcattatataca
ggagtagctggtggagcagaaagtattataataccagaaaaagagtataatgcagataaa
ttatgcaaacaaatactacaaggaaaattaaaagggaaaatgcataacttagttttatta
gcagaaggtgttggaggagctaatgaactagcaaaatatatagaagaggttacagggata
gaaacaagatctacaatattaggacatatacaaaggggtggaagtccaacttgtatggat
agaatattagcttcaagaatggcttataaggcagtagaattattgattagtggtaaatct
tcaagagtagttggtataaaaaatggaaaaataattgatatggatatagatgaagcttta
gcagtagaaagaagttttgaccaagaattatatgacatagcaactattttatccaaataa

DBGET integrated database retrieval system