KEGG   Clostridium botulinum A2: CLM_3860Help
Entry
CLM_3860          CDS       T00883                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cby  Clostridium botulinum A2
Pathway
cby00473  D-Alanine metabolism
cby01100  Metabolic pathways
cby01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLM_3860 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CLM_3860 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cby01011]
    CLM_3860 (alr)
Enzymes [BR:cby01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLM_3860 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cby01011]
 Precursor biosynthesis
  Racemase
   CLM_3860 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C MazG_C
Motif
Other DBs
NCBI-ProteinID: ACO83977
UniProt: C1FML6
LinkDB All DBs
Position
complement(3904491..3905651)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDLDNLQHNLKQIKKICGNKEIIGVIKANAYGHGAMEIAPTLLENGVSR
LAVAVLSEAMELRMSGVKEPIMILGYTPWALGDMLLDNDIEQSVYSYNDALELSKIAVLK
RKILKIHIVVDTGMGRIGFLPTKESVEDVYKISKLPNIEIEGVFSHFSSADESDKDYTLY
QMNKYNAFINKLEEKNIQVPIKHIANSAAIIDLENTHLDAVRAGIIMYGYYPSNYVLRNN
INLKPVMSLKTSIVHIKKVSSGEYISYGGTFKTKRESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTFIENLKVGDVVTIMGEENGVSYTAEDIASQIGTISYE
VICNVNKRVPRVYKKDGKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaatcgatctagataatttacaacataac
ttaaaacaaataaaaaaaatatgtggaaataaagaaataataggggttataaaggctaat
gcatatggacatggagccatggaaatagcccctactcttttagaaaatggagtaagtaga
ttagcagtggcggttttaagtgaggctatggagcttagaatgagtggagtaaaggagccc
attatgatattaggttatacaccatgggctttaggagatatgcttttagataatgatata
gaacaatctgtatactcttataatgatgctttagaattatctaaaatagcggtgctaaaa
agaaaaatattaaaaatacatatagtggtagatactggcatggggagaattgggttttta
cctacaaaagaaagtgtagaagatgtatataaaataagtaagttgcctaatattgaaata
gaaggggtattttctcatttttcttctgctgacgagtcagacaaagattatactttgtat
caaatgaataagtacaatgcatttataaacaaattagaggagaaaaatattcaagtacct
ataaagcatattgctaatagcgcagctataattgatttagaaaatactcatttagatgca
gtaagagcgggtattataatgtatggatactatccgtccaattatgtactaagaaataat
ataaatctgaaaccagtaatgtctttaaaaaccagtatagtacacataaaaaaagtatct
tcgggagaatatataagttatggcggaactttcaaaacaaagagagaaagcataatagct
accttacctataggttatgcagatggatataatagattattaagcaataaaggaaaagtt
atagttaacggcaaacttgctccagtaataggaagagtttgtatggatcaatgtatgata
gatgtaacttttatagaaaatttaaaagttggagatgtggttacaattatgggggaggaa
aatggagtaagctatactgcagaggatatagcatcacaaataggcactataagttatgaa
gttatatgtaatgtaaataagagggtaccaagagtatataagaaggatggcaaaattata
aatgtagtaaattacatataa

DBGET integrated database retrieval system