KEGG   Clostridium beijerinckii ATCC 35702: Cbs_1130Help
Entry
Cbs_1130          CDS       T03415                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cbs_1130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbz02000]
    Cbs_1130
Enzymes [BR:cbz01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Cbs_1130
Transporters [BR:cbz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Cbs_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_22 AAA_29 AAA_30 AAA_18 AAA Rad17 AAA_16 PRK AAA_33 AAA_25 Adeno_IVa2 ATPase_2 AAA_23 IstB_IS21 AAA_24 RNA_helicase G-alpha AAA_28 ATP-synt_ab AAA_14 AAA_5 NACHT
Motif
Other DBs
NCBI-ProteinID: AIU04503
LinkDB All DBs
Position
1347307..1348056
Genome map
AA seq 249 aa AA seqDB search
MNIIETKDLCLYYGDNQALKDINMSINKNEVTALIGPSGCGKSTFLRTLNRMNDLIEIVK
ITGEVFFEGKDIYKDYDDIYLRERIGMVFQRPNPFPMSIYDNIAYGPRIHGTKNKKILDE
IVEKSLRGAALWDETKDRLKSSALGMSGGQQQRLCIARTLAVSPEVILMDEPTSALDPIS
TGKMEELMDELKKKYTVIIVTHNMQQAGRIADKTAFFLNGEVIEFGKTEDIFYNPRDKRT
EDYITGRFG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatagaaacaaaagatttatgcttatattatggtgataatcaggctcttaaa
gatataaatatgtctataaataaaaatgaagttacagcacttattggaccttcaggctgc
ggaaaatcaactttcctaagaactttaaatagaatgaatgatttgattgagattgtaaaa
ataactggagaagtgttttttgaaggtaaggatatatataaggactatgatgatatatat
ttaagagaaagaatcggaatggtattccaaagaccaaatccatttccaatgtcgatttat
gataatattgcgtatggacctagaatacacggcacaaaaaataagaagatcttagatgaa
atagtagaaaaaagcttaagaggagcagcgctttgggacgagactaaagataggctaaaa
tcaagtgcgcttggaatgtcaggtgggcaacaacaaagattatgtattgctagaacattg
gcggtttctccagaagtaattttgatggatgaaccaacatctgcattagatccaatatca
actggaaaaatggaagaacttatggatgaattaaagaagaaatatacagttatcattgta
actcataatatgcagcaagcaggaagaatagctgataaaactgcattctttttaaatgga
gaagttatagagttcggaaaaacagaagatatattttataatccaagagataagagaaca
gaagattatattacaggtagatttggctaa

DBGET integrated database retrieval system