KEGG   Clostridium beijerinckii ATCC 35702: Cbs_1151Help
Entry
Cbs_1151          CDS       T03415                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cbz01001]
    Cbs_1151
Enzymes [BR:cbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cbs_1151
Protein kinases [BR:cbz01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cbs_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH CD34_antigen Haspin_kinase RIO1 Env-gp36 MtrF Kdo Fructosamin_kin Insulin_TMD
Motif
Other DBs
NCBI-ProteinID: AIU03197
LinkDB All DBs
Position
1369033..1370979
Genome map
AA seq 648 aa AA seqDB search
MDGIVLGNRYELLEKIGEGGMSEVFKARDNKLNRFVAVKILKKELCDNPDIVEKFKGEAT
AVAALSDNNIVNILDVGTQDEINYIVMEYVKGKTLKDIIKQVGKMNYETAISVAIQIAKA
LDCAHRNNIIHRDVKPQNILVTEDGVMKVTDFGIAKSSNSETITNTSTIMGSAHYLSPEQ
AKGNFIDCRTDLYSLGVVLYEMVTGNLPFQADTAVTIALKHLQEEVVPPKSVNSKIPESL
NQLILKSMEKDPIKRYQNAKEMISDLQRIKDDPNAKIDKEDDNDHTIIMSAVTEQIAKQE
EKLPNKKDDDYDDEDDDDYYYEDDEDEKGSGINKKRIMKITIGVVLALLLIVLGVAAFKM
VSSASANSKEVEVPNIVGKNVDDGKKALEAINLVLVEGGTEASDQPEGTILKMNPDAGTK
VKEKSQIRVIVSGGATKLKMPDLKEYDIDTATTILKSFGLKISDKSEAFSDSVPEGQIIS
QTPKKDTEVTADDKITVVVSKGPEVKTTKVPSVVGKDQDTATGELQDAGLKVSVNSQETQ
DESQNGKVLKQTGEGNRVEQGTTIVITVGKYVAKQDPPVTNNPTQGNTKPGGNGSTPDKN
TGGTGGTTTDTPGKTPNTPGTTNPTGPWDDTNNSQNNTQPKTSNQNHQ
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggatggaattgtacttggaaacagatacgagttgttagaaaaaataggggaaggcgga
atgtcagaagtatttaaggcaagagacaataaattaaataggtttgttgcagttaaaata
cttaagaaagaactttgcgacaaccctgatattgtagaaaaatttaaaggtgaagcaaca
gctgttgcagccttatctgacaataatatagtaaatatactagatgtaggaacacaggat
gaaataaattatattgtaatggaatatgttaaaggaaaaacattaaaagatattataaaa
caagttggaaagatgaattatgaaacagctatatcagttgcaattcaaatagccaaagct
ttagattgtgctcatagaaacaacataatacatagagatgttaagccacaaaatatttta
gtaacagaagatggagttatgaaagtaactgattttggaatagcaaaatcatcaaattct
gaaactattacaaatactagtacaataatgggatctgctcattatctttctccagaacaa
gcaaaaggaaattttattgattgtagaacggatttatattcattaggagttgtattatat
gagatggttactggaaatctcccattccaagcagatactgctgtaactatagctttaaaa
catcttcaagaagaagttgttccgccaaaaagtgttaattcaaagattcctgagagttta
aatcaattaattttaaagtcaatggaaaaggatcctattaagagatatcagaatgctaaa
gaaatgatctcagatctccaaagaataaaggatgatcctaatgcaaagatagataaagaa
gacgacaatgatcatactataataatgtctgctgtgaccgaacagatagcaaagcaagag
gaaaagttgcctaataaaaaagatgatgactatgatgatgaagacgatgatgattattac
tacgaagacgatgaagatgaaaaaggcagtggaataaacaagaagagaataatgaaaata
acaataggtgtagttttagcattattgttaatagttttaggtgttgcagcttttaaaatg
gttagttctgctagtgctaacagcaaagaagttgaggttcctaatatagtaggaaagaat
gttgatgatggaaagaaagcacttgaagctataaatttagttttagtggaaggtggaact
gaagcaagcgatcagccagaaggaactattcttaagatgaacccggatgctggaactaag
gttaaagaaaaaagtcagattagagttattgtaagtggaggagcaacaaaacttaaaatg
cctgatttgaaggagtatgatatagatactgcaactactattttaaaatcctttggactt
aagattagtgataaaagcgaagcttttagcgatagtgtaccagagggacaaataataagt
caaactccgaaaaaagatactgaagtaacagcagatgataagataacagttgttgtaagt
aaaggaccggaagttaagactacaaaagtacctagcgtagttggtaaagaccaagataca
gctacaggcgaattacaagatgctggtttaaaagtatctgtaaattcccaagaaacacaa
gatgagagtcaaaacggtaaagttttaaaacaaacaggagaaggaaatagagtggagcag
ggaactacaattgttataacagttggtaaatatgttgcgaaacaagatccacctgtaact
aataatcctactcaaggaaatactaagccgggtggaaatggaagtactcctgataaaaat
actggaggaacaggtggtactactacggatacaccaggaaagactcctaatactccaggc
acaactaatcctacaggcccatgggatgatacaaataacagtcaaaacaacactcaacct
aaaacatcaaatcaaaaccatcaatag

DBGET integrated database retrieval system