KEGG   Clostridium beijerinckii ATCC 35702: Cbs_2134Help
Entry
Cbs_2134          CDS       T03415                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cbs_2134
Enzymes [BR:cbz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Cbs_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C NAD_binding_8 NAD_binding_7 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AIU02250
LinkDB All DBs
Position
complement(2488809..2490338)
Genome map
AA seq 509 aa AA seqDB search
MILDKDIKQQLAQYLELMEGTVLIKVSADSDDISNTMVSLVDELVSMSPKIKAEKSKLLR
TPSFSINRTDEETGVAFAGIPLGHEFNSLVLALLQVSGRAPKIDQKTIDSIKNIKGEYHF
ETYISLSCHNCPEVVQSLNLISILNPKVTHTMIDGAVFKEEIESKNILAVPSVYLNGEFF
ASGRMTIEEILAKIGEAPVSENFADKDPYDMLVVGGGPAGASAAIYAARKGIRTGIIVER
FGGQVLDTIGIENFISIKYTEGPKLAASLEEHVKDYNVDIVNLQRAKTIEKKDLIEIELE
NGARLKSKTVIISTGARWRNVGVPGEEEFKNKGVTYCPHCDGPLFKGKHVAVIGGGNSGI
EAAIDLAGVASHVTVFEFMPELKADSVLQDRLYSLNNITVLKNVQTKEITGTDKVNGITY
IERDTGEIKHVELDGVFVQIGLVPNTDWLGETVDRNKSGEIIIDNHGATNVPGVFAAGDC
TNTPYKQIIISMGSGATAALGAFEYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatactagataaagatataaaacaacaattagctcaatatcttgagcttatggaaggc
actgtacttataaaagtcagtgctgattccgatgatatatccaacactatggtttctctc
gtagatgaactagtttctatgtctccaaaaataaaagctgaaaaatcaaaattattaaga
actcctagctttagcataaatcgtactgatgaagaaactggtgtagcttttgcaggaatc
cctttaggacatgaatttaattcattagtactagctcttctacaagttagcggaagagcc
ccaaaaattgatcagaaaacaattgattcaattaagaacattaaaggagaataccatttt
gaaacttatattagtttaagctgtcataactgcccagaagttgttcaatctctaaattta
attagcatccttaatccaaaggtcactcatacaatgattgatggtgccgtttttaaagaa
gagatagaaagtaaaaatatacttgcagtaccatcagtttatttaaatggagaattcttt
gcaagtggccgcatgactatcgaagaaattcttgcaaaaatcggagaagccccagtttca
gaaaattttgcagataaagatccatacgatatgcttgttgttggcggcggtcctgcaggt
gcaagtgctgctatttatgcagctcgtaaaggcattcgtactggaattatcgttgaacgt
tttggtggtcaagtattagatactataggtattgaaaactttataagtattaaatataca
gaaggccctaaacttgcagcaagccttgaagagcatgtcaaagactataacgttgatata
gtaaacttacaacgtgctaagactatagaaaaaaaagaccttattgagattgaactagaa
aatggtgcacgtttaaagagtaaaacggtaataatttcgacaggtgcccgctggaggaat
gtcggtgttcctggagaagaagagttcaagaataaaggtgtgacatattgtcctcactgt
gatggccctttatttaaagggaaacatgttgcagtcatcggtggaggtaattcaggcatc
gaagctgccattgaccttgctggagttgctagtcacgtaactgtttttgaatttatgcca
gaacttaaagcagattcagttttgcaagatcgtctttacagtttgaataatataaccgtc
ttaaaaaatgttcagactaaagaaattactggaactgataaggtaaatggaattacctat
attgaacgtgacacaggagaaattaagcatgttgaattagatggtgtatttgtccaaatt
ggacttgtgccaaatactgattggttaggagaaacagtcgatcgtaataagtcaggcgaa
attataattgataaccatggtgctactaatgtaccaggagtatttgctgcaggagattgc
actaataccccatacaagcaaataattatttccatgggatcaggagcaacagctgcctta
ggtgcatttgaatatctaataagaaactaa

DBGET integrated database retrieval system