KEGG   Clostridium beijerinckii ATCC 35702: Cbs_2832Help
Entry
Cbs_2832          CDS       T03415                                 

Definition
(GenBank) glycoside hydrolase family protein
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbz  Clostridium beijerinckii ATCC 35702
Pathway
cbz00010  Glycolysis / Gluconeogenesis
cbz00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cbs_2832
   00500 Starch and sucrose metabolism
    Cbs_2832
Enzymes [BR:cbz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Cbs_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIU02364
LinkDB All DBs
Position
complement(3298123..3299538)
Genome map
AA seq 471 aa AA seqDB search
MSIKFPEGFLWGGATAANQFEGAYNEDGKGLSTQDIAPKGVMGALTDEPTEDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPNGDDKEPNEKGLQFYDNVFDELAKYGIET
LVTISHYETPLALAKNYDGWVNRKLIGFFENYVRTIFNRYKDKVKYWLTFNEINSATHFP
YMSAGIWTPKEQLNKQDLYQAMHHELVASALAVKIGHEINPKFKIGCMILGVPNYPLTPK
PSDVLKAMEADRENLFFGDVHVRGEYPRYMNRFFKENNIEIKMEPGDKEILKNTVDFVSF
SYYMSSCASADPEKNIKGKGNLIGGVPNPYLKASDWGWQIDPEGLRYMLNLFYDRYQKPL
FIVENGLGAVDELINDENGNKTVNDDYRINYLNDHLVQVGEAIEDGVEVMGYTTWGCIDL
VSASTAELKKRYGFIYVDRHDDGSGTLERYKKKSFYWYKEVIATNGAHLKK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaatttccagaaggatttttatggggaggagctacagctgctaaccaattt
gaaggtgcatacaatgaagacggaaaaggattatctactcaggatatagcacctaaaggt
gtgatgggagctttaacagatgaaccaacagaagataatatgaaacttataggaattgat
ttttatcatagatataaagaagatattaagctatttgcagaaatgggcttcaaagttttc
agactatctattgcttggtcaagaatatttccaaatggtgatgataaagagcccaatgaa
aagggattacaattttatgataatgtatttgatgagttagctaagtatggaatagagaca
ctagttacaatttctcactatgagacaccacttgcactagctaagaattatgatggctgg
gtaaatagaaagctaataggatttttcgaaaactatgtaagaacaatatttaacagatat
aaagataaggtgaaatattggctaactttcaatgaaataaattctgcaactcatttccca
tatatgagcgctggaatatggacaccaaaagaacaattaaacaagcaggatttatatcag
gctatgcatcatgaactagtagcaagtgcacttgcggtaaaaatcggtcatgaaataaat
ccaaaattcaaaattggatgcatgattcttggggtaccaaactatccattaacaccaaaa
ccaagtgatgtacttaaggcaatggaagctgatagggagaatcttttctttggagatgtt
catgtaagaggagaatatccaagatatatgaatagattttttaaggaaaacaacatagaa
ataaaaatggaacctggtgataaagaaatactaaagaatacagtagattttgtttcattt
agttattatatgagctcgtgtgcaagtgcagatcctgaaaagaatattaagggaaaagga
aatctcattggcggagtaccaaatccgtatttgaaagcttcagattggggatggcaaata
gatccagaaggattaagatacatgcttaacttattctatgacagatatcaaaaaccattg
tttatagttgaaaatggtttaggagctgttgacgaattaataaatgatgaaaatggaaat
aagacagtaaatgatgattatagaataaactacttaaatgatcacttagttcaagtagga
gaagctattgaagatggtgttgaagttatgggatacactacatggggatgcatagattta
gtaagtgcatcaacagctgaacttaaaaagagatacggattcatatatgtagataggcat
gatgatggaagtggaactctagaaagatataagaaaaagagcttttattggtataaagaa
gttattgctacaaatggagctcatttaaaaaaataa

DBGET integrated database retrieval system