KEGG   Chlamydia caviae: CCA_00345Help
Entry
CCA_00345         CDS       T00125                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cca  Chlamydia caviae
Brite
Enzymes [BR:cca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CCA_00345 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: AAP05093
UniProt: Q823R1
LinkDB All DBs
Position
397180..397797
Genome map
AA seq 205 aa AA seqDB search
MTFVPYTLPELPYDYDALEPVISAEIMLLHHQKHHQSYINNLNEALKKLDVAGVQQDLTR
LIALEPALRFNGGGHINHSLFWEMLAPVDRGGGVPPKHGLLKLIEKFWGTFDNFLKEFIE
FAAPIQGSGWAWLAFCPKKQELMLCATANQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPRVINWGYIEKRFSETTN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgttccctatactttgcccgaattgccctacgattacgatgctttagaacca
gtgattagcgcagaaattatgcttttacatcatcaaaagcaccaccaaagttatataaat
aatttgaatgaagccttgaagaaattagacgttgctggtgttcagcaagatcttacacgc
ctgattgccttagagcctgccttacgttttaatggcgggggacatattaaccactctcta
ttttgggaaatgctcgctccagtagatcgtggcggcggcgtacccccaaaacatgggttg
ctcaagctgattgagaaattctggggaactttcgataattttttaaaagaatttattgaa
tttgcagctcctattcaaggatcgggatgggcgtggctagctttttgtccaaaaaaacag
gagcttatgctatgtgcaacagcaaatcaggatcctctagaggcgaccactggtaaggtg
ccccttctcggagtggatgtctgggaacatgcttactatctccagtataaaaatgttaga
ttagattatttaaaagctattcctcgagtaattaattggggatatattgaaaaaagattc
tctgagacaactaattaa

DBGET integrated database retrieval system