KEGG   Chlamydia caviae: CCA_00388Help
Entry
CCA_00388         CDS       T00125                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cca  Chlamydia caviae
Pathway
cca00061  Fatty acid biosynthesis
cca00780  Biotin metabolism
cca01100  Metabolic pathways
cca01130  Biosynthesis of antibiotics
cca01212  Fatty acid metabolism
Module
cca_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CCA_00388 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CCA_00388 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CCA_00388 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cca01004]
    CCA_00388 (fabI)
Enzymes [BR:cca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CCA_00388 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CCA_00388 (fabI)
Lipid biosynthesis proteins [BR:cca01004]
 Fatty acid synthase
  Component type
   CCA_00388 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AAP05135
UniProt: Q820E8
LinkDB All DBs
Position
complement(437581..438480)
Genome map
AA seq 299 aa AA seqDB search
MLKIDLTGKVAFIAGIGDDQGYGWGIAKVLAEAGATIIVGTWVPIYKIFSQSWDLGKFDE
SRKLSDGSLLEIKKVYPMDASFDKPEDVPQDITENKRYKGISGYTISEVVEQVTKDFGHI
DILIHSLANSPEISKPLLETSRKGYLAALSTSSYSLVSLLAHFGPIMHPGGSSISLTYLA
SSRAVPGYGGGMSAAKAALESDTKMLAWEAGRKWGIRVNTISAGPLASRAGKAIGFIEQM
VDYYLDWTPIPNPMTTEQVGAAAAFLVSPLASAITGETLYVDHGANIMGIGPEMLPKNS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagatcgatttaactggcaaagtagcttttatagcgggcattggtgatgatcag
ggctatggctggggaatcgctaaagtactagcagaagcaggagctactattattgtaggc
acctgggtacctatttataaaatcttctcccaatcttgggatttaggaaaatttgacgaa
tcaagaaagctatccgatggaagcctcttagaaatcaaaaaagtctatcctatggatgca
agctttgataaacctgaagatgttcctcaagatattacggaaaacaaacgttacaaaggg
atctcaggatatactatttctgaggttgttgagcaagtaacaaaggatttcggtcatatt
gatattttaatccattccctagcgaatagtccggaaatttctaaaccacttttagaaaca
tcacgcaaaggttatctagcagcattaagcacttcgagttattctctagtgagtttatta
gcccacttcggccccattatgcatcccggaggcagcagcatttccttaacttatttagct
tcttcacgtgccgtacctggctatggaggcggcatgagcgctgcaaaagctgcattagaa
agtgatacgaaaatgcttgcttgggaagcaggaagaaaatggggcattcgtgtaaatacc
atttctgcagggcctctagcgagccgtgcagggaaagccatcgggtttattgaacaaatg
gtagattactacttagattggactccaatccccaaccctatgacaacagaacaggtcggg
gctgctgctgcatttttagtttcccctcttgccagtgcaattaccggagaaactctctat
gtagatcatggagcaaatattatgggaattggccctgaaatgcttcctaagaattcctaa

DBGET integrated database retrieval system