KEGG   Cyanistes caeruleus (blue tit): 111923054Help
Entry
111923054         CDS       T05602                                 

Gene name
TUBGCP6
Definition
(RefSeq) gamma-tubulin complex component 6
  KO
K16573  gamma-tubulin complex component 6
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccae03036]
    111923054 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ccae04812]
    111923054 (TUBGCP6)
Chromosome and associated proteins [BR:ccae03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     111923054 (TUBGCP6)
Cytoskeleton proteins [BR:ccae04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     111923054 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl GCP_C_terminal GCP_N_terminal DUF4573
Motif
Other DBs
NCBI-GeneID: 111923054
NCBI-ProteinID: XP_023774447
LinkDB All DBs
Position
1
AA seq 2394 aa AA seqDB search
MASGTALIYDEEMTTHKLLWSDPICDIEVPERLSSSYEQLRSYQLVERCVHVPAREGSEE
EILLVHSLEHLEVAKSTQTMNEEELKRVSENYDAFFFHPSTFHCARLAVGATLQLVDAVM
SGKVRNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIVDWDVHHGQG
TQYIFEEDPSWNKVGMGNSDYLAAFFHVLLPMAFEFDPELVIVSSGYDSGIGDPEGQMNA
TPEVFSHLTHFLMQLANGKLCVILEGGYHLKSLGESVCMTVKTLLGDPVPQITGEMAPCL
SAVESIQNVRAAHKPYWKWLAYEDTSFLQNLSTKSHLLKKTNSSPSTELESKITNSNNTV
KVERFLELHMKNILFPVPPVKTATAGSEGSEHFLPEHVQLVKEMDKSEVKALVSGFYADL
VKEDETLLSLGSMFVILDKILKKEVCNGIAATPTAALSAAVALRHSVQFGLQRVLCVFVG
DMQMIPNTEDGRMLIINICEKEQSEKSSCKHYISLNWKEDAEGNDFFSAVLGFILPVAYS
YQPNLTVIAVGPNRSLGISGISLLVALLQGLAESRIFAVIEDTEISLMQSVAKALLGAST
PPFGIYVPPTQEKVNKIKALRDQFQQEWKMLQCSGLPSHEIRDPDCNCPNPTVSFEMESI
TQLFNDLCEAHLTGLPWKVHLGRQKISKRRAKQNLKRVAYNALFMNLFQDEARKLQSNVS
RLPVKNKILMLSFNLRVAGLGAQADRLENLVEELEAAECLPFTEVNSVLDLLVQLAGTGP
PQLVPQKKDYFLNNKYVGRNVKYQGYDYYDVSVFEADIQSLITNEECQFNDTIQQTLQIM
EAAPGTGLPAIGLFSQGCPAGDKFEKETRVSLFGALVHSRTYDMDIKLDLPPVPDNADLS
GLAIKVPQSIDQSEDEGFQSASNLTPDSQSEPSMTPDIDLWDAVLTYGPSKRRCWERIGY
PPGKKEEPYLTEAGREAFDKFYKLREGELQLFTNTVLQLPQLVLVKEPELVKDVLNVLIG
VVSTTFSLNQSAQSFVIKEGVYVSGTSPETMHNLLSEVAEYGTYYTRLSRFSLQPVLDSS
YSKGLVFQAFTSGLRKYLQYYRACVLSTPPTLSLLTISFLFRKLGRQLRYLAELCGVGTT
ALGISGGAGTSFPTGVKLLSYLYKEALNNCSNEHYPVLLSLLKTSCEPYTRFIYDWVYSG
VFRDVYGEFMIQVNEDYLCFRDKHYWTHGYVLISKEVEDCVPVFLKHIANDVYICGKTIN
LLKLCCPRHYICWSDIPVPRISVIFSLEELKEIERDCAVYVGRMERIARYSSISKEEKDL
RMEIAKQELIVHARETASKVLKAISDKQVSERMALDAKKREQFQKLKEQFAKDQERRLAI
RQEEIDDDFSYARELREREKRLKALEEELEKKARQELIDHYSKLSDDAARREQRTLWKIQ
RHKLETARLKFLLEDQKRIEEMLEKLPDENYRRKLDIIPFKQCQLALDKNPVEKDPPSEV
SFVKPLHSNETVARIESEPEQGYAAAADKALPMPEPANNNADEHFQPKAMGSESSLQNSE
KACSSLYSAESLRESNVNIEDFLSKPQDEQSVAVGMQGSLLDEAFQNINSDLSETLQVSE
SQPVLRGAPEDNAPLHQQSEYDFNTVLRPSAAWQGHVGVGENVFDEDDRRPRWNIHGYAS
DASIRVGEYVLQVDTYQPHSSAYGHSSDSHIKSSSYTSEVESRRPRWNVHGHVSEAHIKI
GEYASEIETSRPRWNIHGHASEANIKIGEYVSNVAPTRPRWSSHGHASDSNIKVGENVSE
VVSARPRWNIHGHASQSHIKIGELVSDTEPLKSRWSPFGHASQSSIQIGKWAPSTENDPI
PHRKTISGSSSDSTIQTLLYSEELSPAEGSRNEAKPLQVKEETLPQSQISDNVTDFPDAI
KDEKKDNAIEKKQEVIADTVNKDPSPDSSQSLQREEPEKAIPQDTQETLSSEANALKEEE
GKEEDTWKKEQAYLKALSDQYCIEKYQDSYDLMSEPPVSHLLHHVIPRSYTFPVDPMVQS
ATDETAVQLSELLSLPVLMKRSITAPLVSHVSLVNKAIVDYYFVELNVEKHFEALRHFLL
MEDGEFAQSLSDLLFEKLGSGQTPGELLNPLVLNSILNKALQYSLHGDTQLASNLSFALK
YLPEMFKPNAPDALSCLELRYKVDWPLNIVITESCMNKYNKIFSFLLQLKHMVWTLKDVW
FHLKRTALVSRASNSVQFRQLQLYKHEMQHFVKVIQGYIANQILHVTWCEFGNKLSSVGN
LEEIHRTHAEYLNKAIFRGLLTEKAAPVMNIIHSIFSLILKFRSQLISQSWSFDAGKQMA
VHPNFGLMQQSYNTFKYYSHFLFKVVTKLVNRGYQPHLEDFLLRINFNNYYKDN
NT seq 7185 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcgctgatttatgatgaggagatgaccactcacaaactactttgg
agtgatcccatttgtgatattgaagtgccagaaagactttcatcctcctatgagcagctt
agaagttaccagcttgtggagagatgtgtccatgtacctgccagagaaggaagcgaggag
gagatcctgttggttcacagtttagagcacctggaagtggcaaaaagtactcagacaatg
aatgaggaggagctgaaaagggtctctgaaaattatgatgcttttttctttcatccgagc
actttccactgtgccagattagcagtaggagcaactttgcagctggtggacgctgtgatg
tcaggaaaagtgcgcaatggaatggcattagtcagacctccaggtcaccacagccagaga
aatgcagctaacgggttctgtttgttcaacaacgttgctattgcagcagaatatgcaaaa
ctgaaatatggtctgcagagaatcctaattgttgactgggatgtgcaccacgggcaagga
acccaatatatatttgaagaagatccaagttggaataaggttgggatgggaaattcagat
taccttgctgcatttttccatgtgttgcttccgatggcttttgagtttgatcctgaactg
gtaattgtctcctctggatatgattctggaattggtgaccctgaaggtcagatgaatgcc
actcctgaggttttttcccatcttacccatttcctgatgcaattagctaatggaaagctg
tgtgtcatcctagagggtggataccacttgaaatcattgggtgaatcagtgtgcatgact
gtaaaaactttgcttggagatcctgtacctcaaataactggagaaatggcaccttgtcta
agtgctgttgaatctattcaaaatgtgagagcagcacataaaccctactggaaatggttg
gcttatgaagatacatcatttttacaaaatttgagcaccaaatcacacttactaaagaag
actaattcaagtccctccacagaacttgaatctaagataactaacagtaacaacactgtc
aaagtagaaaggtttttggaattgcatatgaaaaatattctatttccagtgcctcctgtc
aaaacagcaacagctggctctgaaggttcagaacattttctccctgaacatgttcagctt
gtgaaggaaatggacaaaagtgaagtaaaagctcttgtcagtggcttttatgcagacctc
gtgaaagaggacgaaactttgctctctcttggcagtatgtttgtgatcctagataaaata
ctgaagaaggaggtgtgtaatggaattgcagcaacacccacagctgctctttctgctgct
gttgcactaagacattctgttcagtttggattacaaagagtgctttgtgtatttgttgga
gacatgcagatgataccaaacacagaagatggaagaatgcttatcataaacatctgtgag
aaagaacagtctgaaaagagcagctgcaaacactatatttctctaaactggaaagaggat
gctgaaggaaatgatttcttttctgctgtacttggattcattcttcctgtagcatatagt
taccaaccaaacttaacagtaatagctgttggaccaaacagaagccttggaataagtggg
atttctctgcttgttgctttactacaagggttagctgagtctcgaatttttgctgtgatt
gaggacacagagataagtttaatgcaaagtgtagccaaagccttactgggtgcttctaca
cctccctttggaatttatgtacctcctacccaagaaaaagtaaataaaataaaagcatta
agagaccagtttcagcaggaatggaaaatgcttcagtgttcaggtcttccttcccatgaa
atcagagatccagactgtaactgcccaaacccgacagtttcatttgaaatggagagcatt
acacagttgttcaatgacttgtgtgaagcacacttgacaggtttgccatggaaggttcac
ttaggcaggcagaagatcagcaagaggagggctaagcaaaatctgaaaagggttgcttat
aatgccctgttcatgaacctttttcaagatgaggctcgtaagctgcaatcaaatgtttcc
agactcccagtgaagaacaaaattttgatgctgtctttcaacttgagagttgctggccta
ggtgctcaagcagatagactggagaatcttgtggaggagctggaagcagctgaatgttta
ccatttactgaagttaattctgtcttagatctcttagtacagcttgctggaacaggtcct
cctcagctggtaccacaaaaaaaggactattttctgaacaacaaatatgttgggaggaat
gtcaaataccagggatatgattattacgatgtaagtgtgtttgaagctgacatacagtct
ctgataacaaacgaagagtgtcagttcaatgacacaattcagcagacacttcagataatg
gaggctgcacctggcactggactccctgccatagggctgttctcacagggctgtcctgct
ggggacaagtttgagaaggaaacgcgcgtctcactcttcggtgctcttgtccacagccgt
acgtatgatatggacatcaagttggatttaccaccagtgcctgacaatgcagatttgtct
ggacttgccattaaagttcctcaaagtatagaccagtcagaagatgagggattccagtca
gcatccaatctgactcctgattctcagtcagagccgagcatgactccagacatagacttg
tgggatgcagtgcttacatatggacccagcaaacgaagatgttgggaaagaattgggtac
ccacctggtaaaaaagaggaaccatatcttactgaagctggaagagaagcttttgacaaa
ttttataaacttcgagaaggggaattacagctgtttactaatactgtacttcagcttcct
cagcttgtgctggtgaaagaacctgaactggttaaggatgtcttgaatgtcctcattggt
gtggtatccactacattttcactcaatcagtctgctcagtcatttgtgataaaggagggg
gtgtatgtatctggaacatcaccagagacaatgcataacttgctctcggaagttgcagag
tatggaacctattacacacggctaagtcgtttttctcttcagccagttttggattcctca
tacagcaaaggactcgtatttcaggcattcacaagtggactgagaaagtatcttcaatat
taccgagcctgtgttttgtcaacacctcctactttaagtcttctaacaatcagctttcta
tttagaaaattaggtcgtcagctgaggtatttagctgaactgtgtggcgtaggaacaaca
gccctggggatcagtggtggagctggtacttcatttcctacgggtgttaaattgctttca
tatctgtacaaagaggctctcaacaattgtagcaatgagcattatccagttcttctgtct
ttgttgaagacaagctgtgaaccatacacaagatttatctatgattgggtatacagtggt
gtattcagagatgtttatggagaatttatgattcaggtgaatgaggattatctttgtttc
agagataaacattattggactcatggttatgttttgatttcaaaagaagtggaagactgt
gtccctgtatttcttaaacatattgctaatgatgtgtacatatgtgggaaaaccataaac
ttgctgaaattgtgctgtcctaggcattatatatgttggtcagatatacctgttccccgg
atttcagttattttttcacttgaagaactgaaagaaatagagagagattgtgcagtgtac
gtaggtcgaatggaaagaattgcccgatacagttccataagcaaggaggaaaaggatttg
cgcatggaaatagccaaacaagaattaatagttcatgctcgggaaactgctagcaaagta
ctaaaagccattagtgacaagcaagtgtcagaacgaatggctttggatgcaaagaaacgg
gaacagtttcagaagctgaaagaacagtttgcaaaggaccaagagcgtcgtcttgccata
aggcaggaggagattgatgatgatttcagctatgcccgagagctcagagagagagaaaaa
agactgaaagctttagaagaagaactggaaaaaaaggcaaggcaggaattaattgaccat
tatagcaaactttctgatgatgcagcccgtagggaacaaagaacgttatggaaaatccag
cgccacaagttggaaacagcccgtcttaagtttctgttagaagatcaaaaacgcattgag
gaaatgcttgaaaaacttccagatgaaaactacagaagaaaattagatattattcctttt
aaacagtgccagttggctttggataaaaaccctgttgagaaagatccaccttcagaagtg
tcttttgtgaaacctctgcattctaatgagacagttgccagaatagaatctgagcctgag
cagggatatgctgcggctgctgacaaagcactgcctatgccagagccagcaaataataat
gctgatgagcattttcagcctaaagcaatgggatctgaaagcagtctccaaaattcagag
aaagcatgcagttctctatacagtgctgagtccttgcgtgaatccaatgtgaatatagaa
gatttcttatcaaagccacaagatgaacagtctgttgctgttggaatgcaaggatctttg
ctagatgaagctttccaaaatattaactcagatctttctgagactttgcaagtgagtgaa
agtcagcctgtcttgagaggagcaccagaagacaatgcaccattgcatcagcaaagcgag
tatgattttaatacagttctcagaccatctgcagcttggcagggacatgttggagttggg
gaaaatgtatttgatgaggatgacagaaggcctcggtggaatattcatggatatgcatct
gatgccagcattagagtgggagaatatgtacttcaagtggacacttaccagccacattca
agtgcttatgggcattcctcagattcccatataaaaagcagcagctatacttctgaagtt
gaatctagacgaccccgatggaatgttcatgggcatgtttctgaagctcatattaaaatt
ggggaatatgcttcagagatagagacctcaaggcccaggtggaacatccatggacatgct
tctgaagccaatattaagattggagagtatgtgtcaaatgtagctcctacaaggcctcga
tggagcagccatggtcatgcatctgattccaatatcaaggttggtgaaaatgtgtcagag
gtggtctcagccagacctcgttggaacatccatgggcacgcttcacagtcacacatcaaa
atcggagaactggtttcagatacagagcctttgaaatcccgttggagcccatttggacat
gcatcccagtcaagcatccaaatagggaagtgggctccatccacagaaaatgatcccata
cctcatcgtaaaaccatttcaggttcttcatccgactccacaatccagacacttctctac
agtgaagagttatctcctgctgaagggagcagaaatgaagcaaaaccattgcaagttaag
gaagagactttgccacagtcacagatatctgacaatgttacagattttcctgatgctatt
aaagatgaaaaaaaggataatgcaatagaaaagaaacaagaagtaattgcagatactgtc
aataaggacccttctccagattcctcacagagcttacagagagaagaacctgaaaaagcc
attccacaagatactcaagaaactttatcttctgaagctaatgctcttaaggaggaggaa
ggcaaagaggaagatacatggaaaaaagaacaagcttatttgaaagccttatcggatcag
tattgtattgaaaagtatcaagatagttacgatttgatgtcagaaccaccagtttctcat
ctcttgcatcacgtgataccaagatcgtacacatttcctgtggatcctatggtgcagtct
gcaacagatgaaactgctgtacagctgagtgagctcttgtctctgccagtgctgatgaaa
cgttctattactgctccacttgtatctcatgtttcacttgtgaacaaagcaatagttgat
tactactttgtggagctgaatgtagagaagcattttgaagcattgagacactttttgtta
atggaagacggggagtttgctcagtcactcagtgacctgttgtttgagaagcttggatca
ggacaaacacctggtgaattgctgaatccactggttcttaattctatcctaaataaagcg
ctacagtacagtcttcatggtgacacccagcttgcttccaatctttcttttgccctcaag
tatctcccagaaatgttcaagcccaatgctccagatgctctgagttgcttagagctcagg
tacaaggttgactggcctctgaatattgtcattactgagagctgcatgaataaatacaac
aagattttctcctttttgcttcagctgaagcacatggtgtggactctcaaagatgtttgg
tttcacttaaaacgcactgctttggtgagtcgtgcatcgaattctgttcagtttcgacag
ctccagttatataaacatgagatgcagcattttgtgaaagtaattcaaggttatattgct
aatcagattcttcatgttacatggtgtgaatttggaaacaaactgtcttccgtgggcaac
ctagaagaaattcatagaacacatgctgaatacctcaacaaagcaatcttcaggggcctg
ttgacagagaaggcagcccctgtgatgaacatcatacatagcatcttcagccttatttta
aagttccgcagccagctcatctctcagtcgtggagcttcgatgcagggaagcaaatggct
gttcatcccaactttggtctgatgcagcagtcatacaataccttcaagtattactcccat
ttcttattcaaagtggtaacaaagcttgtaaatagaggataccaaccacatttggaggat
tttctgctgcgaattaacttcaataactactacaaggataactga

DBGET integrated database retrieval system