KEGG   Cyanistes caeruleus (blue tit): 111924026Help
Entry
111924026         CDS       T05602                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain isoform X1
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
Enzymes [BR:ccae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     111924026 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 111924026
NCBI-ProteinID: XP_023775739
LinkDB All DBs
Position
2
AA seq 738 aa AA seqDB search
MYRMSETTSINEENKLPLNGRRAIPPNYSNDEENEVPEMEAFGLIPRGFNPRDYLRVVDI
YMFKEPHEINKQEHHTDKYYNPKLIVRRGQAFQIQIDFNRPYKPETDQFWLEFLMGRYPQ
QNKGTYIPILVGNVLKPGQWGAKIIHRENNSIRLFVMSSPTCIIGKFRLYVAVLTPFGIL
RTRRNSATDIYILFNPWCKLDAVYLDDEKEREEYVLNDVGIVFHGNVEDVKSRSWSYGQF
EENILDACLFLMDKAELELSGRGNPIKICRIASAVINSRDDDGVIAGSWTNSYDYGVPPS
AWTGSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLRL
DFFLDDEGKVDTKLTKDSVWNYHCWNEAWMTRPDLPIGFGGWQVVDGTPQETSDGMYRCG
PASVQAIKHGHVCFQFDAPFVYAEVNGDIFYTRLEKNGTQVVENVDTTRIGQLIVTKEVG
GDGMMDITEEYKFREGSDEERLALETAVMYGVKKQSIQDTTYQPQTDVDMDFQAQKAVLG
HDFKVTITFRNKSCNSYTATTYLSGNTVFYTGVTKSEFKKHSFSVKLEPSSSSSFDIVIK
SSEYMSDLLEQASFHFFVTARINETGKILAVQKAIMLEIPTLRIKTKGELVAGKEASVIV
EFTNPLKQNLENVTLRLEGPGVLRTIKKQFGRIPMNSTLTWEVKFIPMRPGLRKMIASLN
SDALRHVYGELSVQIQKP
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggatgtctgaaacaacgagcatcaacgaggagaataaacttcctctgaatggg
agaagagccatcccaccaaactactccaatgatgaagaaaatgaggttcctgagatggaa
gcttttggattgatacctagaggatttaatcctagagattacctgcgtgttgtggatatt
tatatgttcaaggagcctcacgagatcaacaagcaggagcaccacactgacaagtactac
aaccccaagctgatagtgcgtcggggacaggctttccaaatccagattgacttcaaccga
ccctacaagccagagacagaccaattctggctggagtttttgatgggtcgctacccacag
caaaacaaaggcacctacatcccaatcctagtaggcaatgtgctaaaacctggtcagtgg
ggagccaagattatccacagagaaaacaactccattcgactgttcgtcatgtcctccccc
acctgtatcattgggaagtttcgcttgtatgttgctgtcttgactcccttcggcatcctt
cggacacgcaggaattcagcgaccgacatttacatcttgttcaatccctggtgcaagttg
gatgctgtgtacctggatgatgagaaagaaagagaagaatatgtcctgaatgatgttggt
attgtattccatggaaacgtcgaagatgtaaagtcaagaagctggagttacgggcagttt
gaagaaaacattctggatgcttgcctgttcctgatggacaaggcagaactggagctctct
ggtcgtggaaacccaatcaaaatctgccgtattgcctcagcagtgattaactccagggat
gatgacggtgtgattgctggatcctggaccaatagttatgattatggtgttccaccttca
gcctggacgggaagtgtggacattctcttggagtattacagctctaagcagcctgtccga
tatggccagtgctgggtcttcgctggtgtcttcaacacgtttctgagatgcttggggata
cctgcaagactcattaccaactattcttctgcccatgataacaatgccaatttacgcttg
gacttctttttggatgatgaaggaaaagtggacaccaaacttacaaaagattctgtctgg
aattatcattgttggaatgaagcttggatgaccagacctgaccttcccattggttttgga
ggatggcaggttgttgatgggacacctcaagaaaccagtgatggtatgtacaggtgtggt
ccagcctcagttcaagccattaaacatggtcacgtttgtttccaatttgatgctcctttt
gtctatgctgaggtgaatggtgacattttttacacaagactggagaaaaatggaactcaa
gtggtagaaaacgttgacacaacccgtattgggcagctgattgtgaccaaggaagttgga
ggtgatggaatgatggacattactgaggagtacaagttccgagaaggctcagacgaggag
agactggctcttgagactgctgtgatgtatggtgttaaaaagcaaagtatccaagatacc
acgtaccagccacagacagatgttgacatggacttccaggcacaaaaggcagtccttggc
catgactttaaagtcactatcactttcaggaacaaaagttgcaactcctacactgcaact
acctacctttcaggcaacacagtgttctatacaggagtcacaaaaagtgaattcaagaag
cactctttcagtgtaaaactggaaccctcttcatccagctcttttgacattgtgatcaaa
tcgagtgagtacatgagtgacctgctggagcaagcctcctttcatttctttgtgactgcg
cggatcaatgaaacggggaagattctggccgtgcagaaggcgataatgctggaaattccc
accctgcggatcaagaccaaaggcgaactggtagctggtaaggaagcatccgtgattgtg
gaattcaccaatcctctgaaacaaaacctggagaacgtcacgctccgccttgagggacct
ggcgtgctgagaacaataaaaaagcagtttgggagaatcccgatgaactctacattgacc
tgggaagtaaaatttatcccaatgcgaccaggcttacgaaagatgattgcaagcctgaat
tctgatgctttgaggcatgtgtatggtgagctgagtgtccagattcagaaaccatga

DBGET integrated database retrieval system