KEGG   Cyanistes caeruleus (blue tit): 111924068Help
Entry
111924068         CDS       T05602                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00030  Pentose phosphate pathway
ccae00051  Fructose and mannose metabolism
ccae00052  Galactose metabolism
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
ccae01230  Biosynthesis of amino acids
ccae03018  RNA degradation
Module
ccae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111924068 (PFKP)
   00030 Pentose phosphate pathway
    111924068 (PFKP)
   00051 Fructose and mannose metabolism
    111924068 (PFKP)
   00052 Galactose metabolism
    111924068 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111924068 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccae01009]
    111924068 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ccae03019]
    111924068 (PFKP)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111924068 (PFKP)
Protein phosphatases and associated proteins [BR:ccae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111924068 (PFKP)
Messenger RNA biogenesis [BR:ccae03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111924068 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111924068
NCBI-ProteinID: XP_023775796
LinkDB All DBs
Position
2
AA seq 785 aa AA seqDB search
MDHQPKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAFNLLQRGITNLCVIGGDG
SLTGANLFREEWNGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFLEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGMTEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEGGKVFANTDDSVCLLGMRRRN
LVFQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEA
ETGAI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggcgccgggaaggccatcgcggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgacaatattgtagaagtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggcacggtgatcggcagcgcgcgctgcaaatccttccgcacgcgcgagggccggctgcag
gccgccttcaacctgctgcagagagggatcaccaacctctgcgtgatcggcggtgacggc
agcctgactggcgccaacctcttcagggaggagtggaacgggctgctggaagagctggca
cagaaaggaaagattgatgcagaggctgttaagaaatatgcttaccttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgacatgaccataggtactgactca
gctctgcacaggataattgaagttgtggatgccatcatgaccactgctcagagccatcag
aggacatttgttctggaggttatggggcgacactgtgggtatctagctctggttagtgcc
ttagcctgtggtgcagactgggtgtttattcctgaatacccaccagaggaaggctgggaa
gattcaatgtgtgttaagctttcagagaaccgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgtcacaacaagcctataacatcagagaaggttaag
gatcttgtggttcagcggcttggttttgacacccgagtaaccatcctgggtcatgtgcaa
agaggtggaaccccttcagcttttgacagaattcttgcgagtcgtatgggtgtggaagcc
gtgcttgcccttttagaagctactccagatacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagaagttcagaaa
gccatggatgagggaagattccttgaggctgtgaggcttcgtggaaggagctttgaaaac
aatcttaacacgtacaaattactgtcgcacaaaaagccagatgccgagcttccaaagact
aattttaatgtggcagttttaaatgttggtgcccccgcagctggaatgaatgccgcagtg
agggctgcagtgagagttggaatgactgaaggtcacaaaatatttgctgtcattgatggt
tttgaagggttcgctagagggaagataaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatacttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagctgcccgggagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaataatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgtatcaagcagtcg
gccagcggcaccaaacgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggctctggcagcaggagctgatgctgcctacatcttcgaagagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctaagaaatgagaactgcaatgagaactacacaactgatttc
atttatcagctgtattctgaagaaggaaaaggagtttttgactgtcgaaaaaatgtattg
ggccatatgcagcagggtggagcaccttcaccatttgatagaaatttcgggacaaaaatt
tcagcaaaagctatgcagtggatctccaaaaaactgaaagaaacctaccggaaagaagga
ggaaaagtatttgccaataccgatgactcagtttgtttgctgggaatgcggagacgcaac
cttgttttccaacctgtggctgagctcaagagtgaaacagactttgtacacaggattccc
aaggagcagtggtggctgaagctgcgacccctgatgaagatcctggccaagtacaagacc
agctatgatgtgtcagactcaggccagctggaacacgtggccatgctcccaaaggaagct
gagaccggagccatctaa

DBGET integrated database retrieval system