KEGG   Cyanistes caeruleus (blue tit): 111925336Help
Entry
111925336         CDS       T05602                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00020  Citrate cycle (TCA cycle)
ccae00190  Oxidative phosphorylation
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111925336 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111925336 (SDHA)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111925336 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 111925336
NCBI-ProteinID: XP_023777532
LinkDB All DBs
Position
2
AA seq 665 aa AA seqDB search
MAAAAARGLAKRWLRPAAASRAWPAACQAPARNLHFTVYGKKNASTKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQ
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIANTCKPGE
PIPPIKPNAGEESVANLDKLRFADGSIRTSEVRLSMQKAMQNHAAVFRTGSVLQEGCEKL
SQIYGDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKL
RVDEFDYSKPLQGQQKKPFEEHWRKHTLSYVDIPTGKVTLKYRPVIDKTLNEEDCQTVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggctgcgcgggggctggccaagcgctggctgcgaccggccgcggcttcc
cgggcgtggccagcagcatgccaggctcctgcacggaacttacacttcacagtctatgga
aagaaaaatgcctccacgaaggtgtctgactcgatttctacacaatacccagtagtggac
catgaattcgatgcagttgttgtgggtgcaggaggagcaggtttgcgggctgcctttggt
ttgtcagaagctgggtttaacacagcctgtgttaccaagctgttccccacccgctctcat
acagttgctgcacagggagggatcaatgctgctctggggaacatggaagatgataattgg
aggtggcatttctatgacacagtgaaagggtcagactggctgggtgaccaggatgccata
cactacatgactgagcaagccccagctgcggtgatagagctggaaaattatgggatgcca
ttcagcagaactgaagaaggaaaaatctatcagcgtgcatttggtggacagagtcttcag
tttggaaaaggaggacaggcccacagatgctgttgtgttgcagacaggactggacattca
ctcttacatactttgtatggcaggtctctacgatatgatacaagctactttgttgaatat
tttgccttggacctacttatggagaatggagaatgccgtggagttattgccctctgcatt
gaagatggaaccatacatcgttttagagcaaagaacactgtcattgccactggtgggtac
ggccgcacttacttcagctgcacatctgctcataccagtactggtgatggcacggccatg
gtcacacgagctgggctcccttgccaggatttagaatttgtgcagtttcaccctacaggt
atctatggggctggctgccttatcacagaaggatgtcgtggagagggaggtattctgatc
aacagccaaggtgaaagattcatggagagatatgcacctgttgccaaggatctggcttcc
agggatgtagtgtctcgttctatgaccatagaaatccgtgaaggaaggggttgtggtcct
gaaaaagatcacgtgtacttgcagttgcaccacttgccaccacagcagctggcaacccgt
ctcccagggatctctgaaacagccatgatatttgctggagttgatgtcactaaagagcct
atccctgtcctgcctactgtgcattataatatgggaggtattcctactaactacaaggga
caggtgatcacacacgtcaatggtgaggataaggtggtgcctgggttatacgcctgcggg
gaagctgcctctgcatctgtccatggtgcaaatcgacttggagcaaactctcttctggat
ttggtggtctttggtcgtgcttgtgccctgactattgcaaatacatgcaagcctggagag
ccaattcccccaattaaaccaaatgctggtgaagaatcagttgctaatcttgacaagtta
aggtttgctgacggaagcataaggacctcagaagtgcgacttagcatgcagaaggcaatg
caaaaccatgctgctgtatttcgtactggttctgtactccaagaaggctgtgagaaactt
agccaaatttatggtgatctggctcatctaaagacttttgacagaggtattgtatggaac
acagacttggtggagacccttgaactgcagaacctgatgctttgtgctctacaaaccatt
tatggtgctgaggctcgcaaagagtcccggggtgcccatgccagagaggattataagtta
cgggtagatgagtttgactactctaagccactccaaggccaacagaagaagccatttgag
gagcactggagaaagcacaccctgtcatatgtggatatcccaactgggaaggttaccttg
aagtacagaccagtgatcgacaaaaccttgaatgaggaagattgccagactgtcccacca
gcaatccgctcgtactag

DBGET integrated database retrieval system