KEGG   Cyanistes caeruleus (blue tit): 111925581Help
Entry
111925581         CDS       T05602                                 

Gene name
CDC25A
Definition
(RefSeq) M-phase inducer phosphatase 1 isoform X1
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04110  Cell cycle
ccae04218  Cellular senescence
ccae04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111925581 (CDC25A)
   04218 Cellular senescence
    111925581 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111925581 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccae01009]
    111925581 (CDC25A)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccae03400]
    111925581 (CDC25A)
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111925581 (CDC25A)
Protein phosphatases and associated proteins [BR:ccae01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    111925581 (CDC25A)
DNA repair and recombination proteins [BR:ccae03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111925581 (CDC25A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 111925581
NCBI-ProteinID: XP_023777849
LinkDB All DBs
Position
2
AA seq 518 aa AA seqDB search
MDPTPSASHRRRLLLLSPASPASPAVVKALFQDELSPVSDLRLTMEQLGRGQHENLDQDM
GTKNGLHRLASSESTDSGLALDSPSPTTSHDTMEDTFEKAIKSSRLNLRIPFRRIHSLPQ
SLLGSSPALKRNHSDSLDTDAFQPLEQDENKENESFEFKKPTKPASRGSRDGRGVHGARQ
NSSPAQLPMGETASGEQENSRAAFLQQHSLPSSESEDDDGFLELLDDQDLKNDEEMPSDV
SSLWTAPLVMRRADSRAKRCRLFGSSSMSSIAGRTTQKRLERSQEENSPGKSKKRKSLPE
TSKDSTSLKLVRTQPSTAEIESILDSDQRDLIGDFSKSYLFATVDGKHQDLKYIDSEMMV
SVLTGKFESFIKQFVIIDCRYPYEYEGGHIKGAINLHMEEEVENFLLKKPIQPSENKRVI
VVFHCEFSSERGPRMCRFVREQDRLSNEYPNLHYPELYVLKGGYKDFFSRCQSFCEPQSY
RPMHHKDFKEDLKRFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaccccgagcgcttcccaccgccgtcgccttctgcttctctcgccggcgtcc
cccgcctcgcccgcggtggttaaggcgctctttcaggatgagctctcgcctgtctccgat
ctccgcctgaccatggagcagctggggcgcgggcagcatgaaaacctggaccaagatatg
ggaaccaaaaatggattacacagattggcatcttcagagtccacagattcaggtttggct
ttggattctcccagccccacaacctcgcacgacaccatggaggacacgtttgagaaagcg
atcaaatccagcaggctgaaccttcgaatacctttcagaagaatccattccctgccacaa
agcctgctgggctccagccctgctctgaagagaaaccactctgactctctggacactgat
gctttccagcctttggagcaggatgaaaataaggagaatgaatcatttgagtttaagaag
ccaaccaaaccagcttctcgtggctcccgtgatggaaggggtgttcatggagcaaggcag
aattcatctccagctcagctgcccatgggggaaacagcctcgggggagcaggagaactcc
agggcagccttcctgcagcagcattccctgccctcctcggagagcgaggatgatgatggc
ttcctggagctgctggatgaccaggacttgaagaacgatgaggagatgccctcggacgtg
tccagtctctggacagcaccgctggtcatgaggagagcggacagtcgggccaagcggtgc
cggttgttcggctcttcgtccatgtcaagcattgcaggaagaaccacccagaaaaggctg
gagagatcccaggaggagaattctccagggaaaagcaaaaagaggaaaagcctgcctgaa
acatccaaggactcgacgagtctgaagctggtgaggacccagccctccacagcagagatc
gagagcattttggacagtgaccagagagaccttatcggggacttctccaagagttattta
tttgccactgtcgatgggaaacatcaagatttaaaatacatcgactcagaaatgatggtg
tctgtgctgactgggaagtttgagagcttcatcaagcagtttgtgataattgactgtaga
tacccctatgagtacgaagggggacacatcaagggtgccataaacctccacatggaagag
gaggtggaaaatttcctgctgaagaagccgatccagccgtcggagaacaagcgggtcatc
gtggtgttccactgcgagttctcctcggagcggggccctcgcatgtgccggtttgtgagg
gagcaggacaggctgagcaatgagtaccccaacctgcactacccagagctctacgtgctc
aagggaggctacaaggatttcttctcaaggtgccagagcttctgcgagccccagagctac
cgccccatgcaccacaaggacttcaaggaggacctgaagaggttccgcaccaagagccgg
acctgggccggggagaagagcaagagggagatgtacagtcggctcaagaagctctga

DBGET integrated database retrieval system