KEGG   Cyanistes caeruleus (blue tit): 111927672Help
Entry
111927672         CDS       T05602                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04068  FoxO signaling pathway
ccae04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111927672 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111927672 (SOD2)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111927672 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 111927672
NCBI-ProteinID: XP_023780366
LinkDB All DBs
Position
3
AA seq 176 aa AA seqDB search
MQLHHSKHHATYVNNLNVAEEKYKEALAKGDVTTQVSLQPALKFNGGGHINHTIFWTNLS
PNGGGEPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKDQGRLQIAACAN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYAASKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcatcatgccacctacgtgaacaacctgaacgttgccgag
gagaagtacaaagaggcactggcaaaaggtgatgttacaactcaggtgtcacttcaacct
gcactgaagttcaatggtgggggtcatatcaatcacaccatcttctggacaaacctttcc
cccaatggaggaggagagcctaaaggagaattgatggaagccatcaagcgtgactttggt
tcctttgcaaacttcaaggagaagctgacagctgtatcagttggtgttcaaggatcaggc
tgggggtggcttggctataacaaggatcagggccgcctacagatagcggcttgtgcaaat
caagaccctttgcaaggaacaacaggtctcattcctttgctaggcattgacgtatgggaa
catgcttattatcttcaatataaaaatgttcgacctgattatttgaaagccatctggaat
gtgatcaactgggagaatgtatcttcaagatatgcagcttccaaaaagtag

DBGET integrated database retrieval system