KEGG   Cyanistes caeruleus (blue tit): 111928019
Entry
111928019         CDS       T05602                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04020  Calcium signaling pathway
ccae04144  Endocytosis
ccae04510  Focal adhesion
ccae04540  Gap junction
ccae04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111928019 (PDGFRA)
   04020 Calcium signaling pathway
    111928019 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111928019 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111928019 (PDGFRA)
   04540 Gap junction
    111928019 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111928019 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111928019 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccae04090]
    111928019 (PDGFRA)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111928019 (PDGFRA)
Protein kinases [BR:ccae01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111928019 (PDGFRA)
CD molecules [BR:ccae04090]
 Proteins
  111928019 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 111928019
NCBI-ProteinID: XP_023780986
LinkDB
Position
4
AA seq 1125 aa
MALGGQDSLCHRLTNIERACRETQLWAGMEIDFRDNLDSWCWFIADCQFHSVGLGPFLTF
CQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYPVTEGNHRIDIRHEENNSGLFVT
VLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYVPDPDMPFVPSIPEDQFILVEEG
DPAVIPCRTSDPDAQVTLVNSLDKPVYALYDTKQGFIGNFPAGSYTCKTMVKGVEFKSDE
FLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDNEVVNLQWNYPGKVKEKGLIKLD
DIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVKENKKVVITVHDKGFVHLEPQFS
PLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENLTEIVTSSNRVQETRFQSILKLI
RAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISALVDDHHGSAGGQTVRCLAEGTPL
PDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDEKNMVESQVTFQKVEETLVVRCV
ARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVI
ESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVM
KVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDL
VNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSYVILSFENTGDYMDMKQADTTQY
VPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKNLLSDDSSEGLSLLDLLSFTYQV
ARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWM
APESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHAT
NEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKKSYEKIHLDFLKSDHPAVTRMRG
DCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIPLPDIDPVSEDELGKRNRHSSQT
SEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3378 nt   +upstreamnt  +downstreamnt
atggccctgggagggcaggacagcctctgccaccggctgacaaatatagaaagggcctgt
agagagactcagctctgggcaggaatggaaattgatttcagagacaatctggattcctgg
tgctggtttattgcagactgccagtttcactcggtgggcctaggaccattcctaacattt
tgccagcttcctctgccaaccattgttcccaataggaatgaaatggtggtacagctgaat
tccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtacccagtgacc
gagggaaaccacaggatagacattagacacgaagaaaacaacagtggcctcttcgtgaca
gtgctcgaagtaggaaatgcctcggccgcccatacaggcttgtatgtttgctattataac
cacacacaagtggaggacggggaagtggaagggaaggacatctacatctacgtgcctgac
ccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaagaaggt
gatcctgcagttattccttgtcggacaagtgacccagatgctcaagtgactttagttaac
agtttagacaagcctgtgtatgctttatatgacaccaaacaaggcttcataggcaatttt
cctgcgggctcatacacatgcaaaacaatggttaaaggcgtggagttcaaatctgatgag
ttcctcatctatattataagagctacttcacagctgcctgttgaaattgaagctcttaaa
actgtctacaaaacaggcgagacgatcgtagtaacttgtgtggtctttgacaatgaggtg
gttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaacttgat
gatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggcatcagtg
aaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaaggaaaat
aagaaagtagtcattacagttcatgacaaaggctttgttcacctggagccccagtttagc
cctctggaagctgtcaacctgcatgaagtcaaaaactttgttgttgatgtgcaggcttac
ccagcaccaaaaatgtactggttgaaagataatgtgactctgattgaaaatcttacggag
attgttactagttccaacagagtccaggaaacaaggtttcagagtattttaaaattgata
cgggccaaggaggaagacagtggatactatactttggttgctgaaaatgaagatgaaatt
aaaagatacaccttctcattgctaatacaagttccagctctgatctcagctctcgtggat
gatcaccatggctctgcaggtgggcagacagtgagatgtttggcagaggggaccccactt
cctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacctcatgg
acccttttgactaacaatatctctgatatacatatggaagcccacctggatgagaaaaat
atggtggaaagtcaggtgaccttccagaaggtagaggaaaccctggttgtgcgatgtgtg
gcaaggaatgacctcggtgctgttactcgagaactgaagcttgtggctcccaccttgaga
tcagagctgacggtggctgctgctgtcttagtgctgttagtgattgtgataatttcactg
attgtcctagtcatcatatggaaacagaagccaaggtatgagattagatggagagtcatt
gagtctatcagccctgatggccacgagtacatttatgtggacccaatgcaactgccttat
gactccagatgggaatttccacgagatgggttagtgcttggtcggatccttggttctggt
gcatttggaaaagtagttgaagggactgcatatggattgagtcgctctcaaccggtgatg
aaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcactcatg
tctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctgcttgga
gcttgtacaaaatcaggtcctatttacatcattactgaatactgtttttatggggatttg
gtgaactacctgcataagaatagggacaatttcctgaaccgacacccagaaaagcctaaa
aaagatttggatatctttgggatgaaccccgctgatgaaagcacaagaagttatgtgata
ctatcatttgaaaacactggagactacatggacatgaaacaagctgataccactcagtat
gtgccaatgctggaaaggaaggagggctctaaatactctgatattcagagatctgtgtat
gatcggcctgcttcatataagaagaaatccatgtcagaatcagaagtcaaaaaccttctt
tcagatgacagttcagagggcctcagcctactggatttgctgagcttcacctaccaggtt
gcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggctgctcgt
aatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggctagagac
atcatgcatgattccaactatgtctccaagggcagtacttttctcccagtaaaatggatg
gcacctgaaagtatttttgacaacctgtacacaacattaagtgatgtctggtcttatggc
attctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatggtcgat
tctactttctacaataagatcaagagtggataccgaatggccaaacccgatcacgctacc
aatgaagtgtatgagattatggtgaagtgctggaacagtgaaccagagaaaagaccgtct
ttctaccacttgagtgaaattgtggagagcctgctgcctggagagtacaaaaagagctat
gagaagattcatctggacttcctgaaaagtgaccacccagctgtcacacgcatgagaggg
gactgtgacaatgcttacattggtgtaacttacaagaacgaagacaagctaaaggacagg
gagagtggatttgatgagcagaggctgagtgctgacagtggatacatcattcccctgcct
gacattgaccctgtttctgaagatgagcttggcaaaagaaacagacacagttcgcagaca
tctgaagaaagtgccattgaaactggttccagtagctctaccttcatcaagagagaggac
gagaccattgaggacattgacatgatggatgacattgggatcgactcctcagacctggtg
gaggacagcttcctgtaa

DBGET integrated database retrieval system