KEGG   Cyanistes caeruleus (blue tit): 111928486
Entry
111928486         CDS       T05602                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04020  Calcium signaling pathway
ccae04260  Cardiac muscle contraction
ccae04261  Adrenergic signaling in cardiomyocytes
ccae04270  Vascular smooth muscle contraction
ccae04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111928486
   04020 Calcium signaling pathway
    111928486
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111928486
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111928486
   04261 Adrenergic signaling in cardiomyocytes
    111928486
   04270 Vascular smooth muscle contraction
    111928486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccae04040]
    111928486
Ion channels [BR:ccae04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111928486
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 111928486
NCBI-ProteinID: XP_023781591
LinkDB
Position
1
AA seq 2033 aa
MENRMGQKVKHRTRPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIF
TVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAG
FDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELF
MGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNF
AFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFS
KEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTS
ETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWL
VIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFN
RFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVR
SIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWN
SVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEE
EEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKSITADGESPPATKINVDDYQPN
ESEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRF
RVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQILGNADYVFTSIFTLEII
LKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAI
NRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAEC
RGYYITYKDGEVSQPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHM
EDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQC
VEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKE
AMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHT
QCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVM
LFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDK
KCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSIL
GPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMP
LNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAG
DDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAI
SGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSGFPQTFTTQRPLH
INKSGNNHGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVS
TVEGHGTPLSPTICVQEAPWKLPSKRTHYYEALGRSSSRDSQLAIVCQEEVSQDETYDEN
LNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPENNKGEDTRPSPKKGFLCSSALGRRASF
HLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCATPPATP
CNRGWPQQSIPTLRLDGAESSEKLNSSLPSVHCGSRYPEGGGSPRRARPVSLTVPSPSAG
SSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNG
NSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIYISSL
NT seq 6102 nt   +upstreamnt  +downstreamnt
atggagaatagaatggggcagaaggtaaaacacagaacaagaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaagat
gattccaatgccaccaattccaatctggaacgagtggaatatctctttctcataattttt
acagtggaagcatttttaaaagtaatagcatacggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggtagtagggctttttagtgca
attttagaacaagcaaccaaagcagatggggggaattcgataggaggaaaaggtgccgga
tttgatgttaaagcactgcgggctttccgagtattacgtccactacggctggtgtctgga
gttcccagtctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcat
attgccctgctggtgctgtttgtcattattatctatgccatcattggactggagttattc
atggggaagatgcataagacctgctaccatgtgcaagggggactgatagatacacctgcg
gaggacgacccatctccgtgtgccccccagtctgcccacgggcggcagtgtcagaacggc
accgagtgcaaggcgggctgggagggacctaagcacggcatcaccaactttgacaatttt
gcttttgccatgctcacggtgtttcagtgcatcaccatggagggctggacggatgtgctg
tactggatgcaggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtc
atctttggatcctttttcgttctaaatctggttcttggtgtgttgagcggggagttttcc
aaagaaagagaaaaggctaaagctcgaggggatttccagaagctacgggaaaagcaacag
ctagaggaggacctgaagggatacttagattggataactcaagcagaagacattgatcca
gaaaatgaagatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccaccagc
gagaccgagtccgtcaacaccgacaacgtccccggagcggacatggagggcgagaactgc
ggcgccaggctggcgcatcggatctcaaaatcaaaatttagtcgctactggcgccgatgg
aaccgattctgcaggaggaagtgccgtgctgctgtcaagtccaatgttttctattggctg
gtgatcttcctcgtgtttctcaacaccctcaccattgcctctgagcactacaaccagcca
gactggctcacagaggtccaagacactgccaacaaggtgctgctagctcttttcacggca
gagatgctgctgaagatgtacagcctcggtctccaggcctactttgtgtccctcttcaac
cgctttgactgcttcatcgtgtgcgggggcatcctggaaaccatcctggtggagacaaag
atcatgtcacccctgggcatttcggttttgagatgtgtcaggctcctaaggatatttaaa
atcacaagatattggaactccctgagtaatcttgtggcttcactcctgaattcagtccgc
tccattgcctccctgttgctgctcctcttcctcttcatcatcatcttctcactcctgggg
atgcagctctttgggggcaagtttaactttgatgagatgcagaccaggaggagtacattt
gacaacttccctcagtccctcctgactgtgtttcagatcctgactggggaggactggaat
tcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtc
tgtatttacttcatcatcctcttcatctgtggaaactatatcctgctgaatgtatttttg
gccattgctgtggacaaccttgctgatgctgagagtttaacatctgcacagaaagaggag
gaagaggagaaagaaaggaaaaagctcgctaggactgctagtcccgaaaagaaacaggag
atggaaaaaacagctgtggaggaagagacaaaggaagagaaaattgagctgaaatcgatc
actgctgatggagagtccccacctgctaccaagatcaacgtggatgattatcagcccaat
gaaagcgaggaaaagagcccttatcccacaacagaagcaccagcagaggaagatgaggaa
gagcctgagatgcctgtcggccctcgacctcgcccgatgtctgagctgcacctcaaggaa
aaggctgtgcccatgcctgatgccagtgctttcttcatcttcagtcctaacaacaggttc
cgtgtccactgccatcgaatcgttaacgataacattttcaccaacctgatcctatttttc
atcctgctcagcagcatctccctggcagctgaggaccccgtgagacacctctcctttagg
aaccaaatcctaggcaatgcagactatgtcttcactagtatctttacattagaaattatt
cttaagatgacggcctacggggctttcctccacaagggctccttctgcaggaactatttc
aacatcttagacctgctggtggtcagcgtttctctcatctcctttgggatccagtccagt
gccattaatgtggtgaagatcctgcgtgttctgagggtccttagaccactgagggccatc
aacagagccaaaggactgaagcacgtggtccagtgtgtgtttgtcgccatcagaaccatc
gggaacattgtgattgtcaccactttgctgcagttcatgtttgcctgcattggagttcag
ctgttcaagggcaagctgtacagctgcactgacagctccaagcagacagaagcagagtgc
agagggtactacatcacctacaaggatggggaggtcagccagcccatgatacagccccgc
agctgggagaacagcaagttcgacttcgacaacgtcctgactgccatgatggccctcttc
accgtctccaccttcgagggctggccagagttgctgtataggtccattgattcccacatg
gaggatgtgggacccatctataatcacagggttgagatctccatcttctttattatctac
atcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacattt
caggaacaaggagaacaagagtacaagaactgtgagctggacaaaaaccagcgccagtgt
gtagagtatgccctgaaagcccggcccctgcggagatacatccctaaaaaccagtaccag
tacaaagtctggtacgtggtcaactccacctattttgaatacctgatgttcgttctgatc
ctgctgaacaccatctgcctggccatgcaacactatggtcagagctgcatgttcaaggaa
gccatgaatatcctcaacatgctcttcactggcctcttcaccgtggagatggtcctgaaa
ttaatcgccttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctc
atcgtaattggcagcattatagacgtcattctcagtgaaactaatccagctgaacatacc
caatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccga
ctcttccgcgtgatgcgcctcgtcaagctcctgagccgaggggagggcatccggacgctg
ctttggaccttcatcaagtccttccaggctctcccctacgtggctcttttaatagtgatg
ctgttcttcatctacgctgtgattgggatgcaggtgttcggtaaaatcgcgctgaacgac
accacagaaatcaaccgcaacaataacttccagaccttcccccaggcagtgctgctgctt
ttcaggtgtgccacaggtgaggcctggcaggaaatcatgctggcatgtctcccggacaag
aagtgtgacccggagtcggagccggccaactccacggaagccgatcactcctgtggcagc
agcttcgccgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaat
ctttttgtagctgttataatggataacttcgattacctgacacgggactggtccatttta
ggaccacaccacctggatgagtttaaaaggatctgggcagagtatgaccctgaagctaag
ggacggatcaaacacttggatgtggtgacgctgctccggcggatccagcccccgctgggc
ttcgggaagctctgccctcaccgcgtggcttgcaaacgccttgtctccatgaacatgcca
ctgaacagcgatggcaccgtcatgttcaacgccactctctttgcactggtcagaactgca
ctgaggatcaagacagaaggtaacctggagcaagccaacgaagagctgagagcaataatt
aagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgcctcctgcaggt
gatgacgaggtgaccgtggggaagttctacgccactttcttgatccaggagtatttccgg
aagttcaagaagcgcaaggagcaggggctggtggggaagccctcgcagcgcaacgcgctg
tccttacaggctggtctgcgcacactccacgacatcgggccggagatccgacgagcaatt
tctggagacctgacagctgaagaggagctggacaaggccatgaaagaagctgtttctgct
gcctctgaagatgatatcttccggagagctggaggcttgtttggaaaccacgtgagctat
taccaaagcgacggcaggagcgggttcccccagacattcaccacccagagacctttgcac
atcaataagtctggcaacaaccacggagacaccgagtctccatctcacgagaagctggtg
gactccaccttcactcccagcagctactcatcctcaggctccaatgccaacatcaacaac
gccaacaacaccgccctgtgtcgcttccccagcccacccagctaccccagcactgtcagc
acggtggaaggccatgggacccccttgtcacccaccatttgtgtgcaggaggctccctgg
aaactcccatccaaaaggacacattactacgaggcactgggacgctccagttccagagac
agccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaat
ttgaatgaagacattgagtactgtagtgaaccaagtctgctctctaccgaaatgcttgca
taccaggatgatgaaaacagacaactcactccgccagaaaacaacaaaggagaggacacc
cggccctctccgaagaaagggtttctgtgctcctcagctctaggtcgaagagcatctttt
cacttagagtgtttgaaaagacagaagaaccagggcgtggatgtctcgcagaagacagtc
ctgcctttgcatctggtccatcatcaggcattagcagtggccggcctgagtcccctgctc
cagcgaagccattcccccaccatgttctctcggctgtgtgctacacccccggccacgccc
tgcaaccgaggctggccgcaacagagcatcccaacgctgcgcctcgacggggcggaatcc
tcggagaagctcaacagcagcttgccgtcggtgcactgcggctcccggtaccccgagggc
ggcggcagccccaggagagcccggccggtgtccctgaccgtgcccagccccagcgcaggc
agcagccggcagttccacggcagcgccagcagcctggtggaagcggtcttgatttcggaa
ggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccaggagctcgca
gacgcctgcgacatgacgatagaagagatggaaaatgcagcagacaacattctcaatggt
aacagcaagcagagccccaatggcaacctcttgccttttgctaactgcagggacccaggg
caggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtaggataagtcag
gaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system