KEGG   Cyanistes caeruleus (blue tit): 111929429Help
Entry
111929429         CDS       T05602                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin-5
  KO
K17345  tetraspanin-5
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111929429 (TSPAN5)
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111929429 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 111929429
NCBI-ProteinID: XP_023782788
LinkDB All DBs
Position
4
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaagcactacaaggggcctgaagtcagttgttgcatcaaatattttatcttc
ggcttcaatgtcattttctggttccttggcatagcatttcttgggattggattgtgggca
tggaatgaaaagggagtgctgtccaatatctcctccatcactgacctcggaggctttgat
cctgtttggctcttcctagtggtaggaggagttatgttcattttgggatttgcaggatgc
attggagctttacgagagaacacttttcttctcaaatttttctccgtttttcttggaatt
attttcttcttggagctcactgctggtgttctagcatttgttttcaaagactggataaag
gaccagctgtatttctttataaacaacaacatcagagcataccgagatgacattgattta
caaaacctcatagacttcacacaggaatattggcagtgctgtggggcttttggagccgat
gactggaaccttaatatttacttcaattgtacagattccaatgcgagtcgagagcgctgt
ggtgtgccattctcttgctgtactaaagaccctgctgaagatgttattaatactcagtgt
ggctacgatgcaaggcaaaaaccagaagttgatcagcagattgttatctatactaaaggc
tgcgtccctcagtttgagaaatggttgcaggacaaccttaccatagttgctggtatattc
attgggatagcattactgcagatatttgggatatgcttagcccagaatttggttagtgac
attgaggctgtcagagccagctggtaa

DBGET integrated database retrieval system