KEGG   Cyanistes caeruleus (blue tit): 111929620Help
Entry
111929620         CDS       T05602                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00500  Starch and sucrose metabolism
ccae01100  Metabolic pathways
ccae04910  Insulin signaling pathway
Module
ccae_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111929620 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111929620 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccae01003]
    111929620 (GYS2)
Enzymes [BR:ccae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     111929620 (GYS2)
Glycosyltransferases [BR:ccae01003]
 Polysaccharide
  Storage polysaccharide
   111929620 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 111929620
NCBI-ProteinID: XP_023782978
LinkDB All DBs
Position
1
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQCEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWEVSNIGIPFQDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKSPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLKGEIPDLNKI
LDRDDISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWK
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRFPRPSSVPPSPSASQHSSPHHSEA
EDDDEDERYDEDEEAERDRQNIKSPFSLGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgagatccttgtccatgacatctctgaatgggcttcctcagtgtgaggat
gaagacctgcccgtggaggatttgttgctctttgaaatttcctgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactactgcggatgaatggggc
gaaaactatttcctgattggcccctattttgagcagaatgtgaagactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacaccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcttggaacctggacaagtggaaaggtgaattttgggaagtcagcaacata
ggaatcccttttcaggaccgagaagccaacgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgacaagcccaatataattgcccatttc
catgagtggcaggcaggagtgggtttaatcctgtctcgatcacagaaactccctgttgcc
acaatttttactacccatgcaactctgctagggagatacttgtgtgcagccagtattgac
ttttacaacaacctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggagcgggcatctgtacactgtgcccacgtgttcaccacagtctct
cagatcacagctacagaagcagaacatatgcttaaaaaaagccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagactttgtttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgat
gttacagttattgtgttcttcataatgccagcaaagaccaacaatttcaatgtggaaacc
ttgaaaggacaggcagtccgtaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaagaaagctctacaacgccttgctgaaaggagaaatcccagacttgaacaagatt
cttgaccgagatgacataagcattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaatgacccaatcctcaacacc
atccggcgcattgggctgttcaacaaccgcacagaccgcgtgaaagtgatcctacatcca
gagtttctttcttcaacaagccccttgctgcccttggactatgaggagtttgttagaggc
tgccaccttggtgtattcccatcttactatgaaccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggattcggctgtttcatgcag
gaacatgttgctgacccagaagcttacgggatctacatcgtggacaggaggttccgctcg
ccggacgagtcgtgcaaccagctgacccagttcctgtacgggttctgccagcagaaccgg
cgccagaggatcatccagaggaaccgcaccgagcgcctctcggacctcctggactggaaa
tacctgggcaggtattacatgcatgccagacacttggccctcagcagaacgttcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggttccccaggcct
tcatcagtgccgccatcaccctctgcctcccagcattctagcccccaccacagcgaagcc
gaggacgacgatgaggatgagagatatgacgaggatgaggaagctgaaagggacaggcag
aacatcaagtcccccttttcccttggagccttgccacaaggaaaaaagaagcagcatgga
gaatacaggaactga

DBGET integrated database retrieval system