KEGG   Cyanistes caeruleus (blue tit): 111930656
Entry
111930656         CDS       T05602                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04068  FoxO signaling pathway
ccae04110  Cell cycle
ccae04115  p53 signaling pathway
ccae04218  Cellular senescence
ccae04310  Wnt signaling pathway
ccae04340  Hedgehog signaling pathway
ccae04371  Apelin signaling pathway
ccae04510  Focal adhesion
ccae04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111930656 (CCND1)
   04340 Hedgehog signaling pathway
    111930656 (CCND1)
   04371 Apelin signaling pathway
    111930656 (CCND1)
   04068 FoxO signaling pathway
    111930656 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111930656 (CCND1)
   04115 p53 signaling pathway
    111930656 (CCND1)
   04218 Cellular senescence
    111930656 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111930656 (CCND1)
   04530 Tight junction
    111930656 (CCND1)
SSDB
Motif
Pfam: Cyclin_C
Other DBs
NCBI-GeneID: 111930656
NCBI-ProteinID: XP_023784558
LinkDB
Position
5
AA seq 153 aa
MELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRKHAQTFVALCATDIKFISNP
PSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCDPDCLRACQEQIESLLESSL
RQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgat
ttcattgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgt
aaacatgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaaccca
ccttccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaac
actaacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgt
gatccggattgtttacgagcctgccaagaacagattgagtccctcctcgagtccagtcta
cgccaggcacagcagcacaatgtatcttcagaaacaaagactgtagaggacgaagcagac
ctctcctgcacacctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system