Cyanistes caeruleus (blue tit): 111930873 Help Entry 111930873         CDS       T05602                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism ccae  Cyanistes caeruleus (blue tit) Brite KEGG Orthology (KO) [BR:ccae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccae03036]     111930873   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccae04147]     111930873 Chromosome and associated proteins [BR:ccae03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111930873 Exosome [BR:ccae04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111930873 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  111930873 NCBI-ProteinID:  XP_023784942 LinkDB All DBs Position 1 AA seq 101 aa AA seqDB search VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQE ASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt gtcaagaagccgcaccgctaccggcccggcacggtggcgctgcgcgagatccggcgctac cagaagtccacggagctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatc gcgcaggacttcaagaccgacctgcgcttccagagctcggccgtcatggcgctgcaggag gccagcgaggcttacctggtggggctcttcgaggacaccaatctgtgcgccatccacgcc aagcgcgtcaccatcatgcccaaggacatccagctggcccgccgcatccgcggggagcgc gcctga

DBGET integrated database retrieval system