KEGG   Cyanistes caeruleus (blue tit): 111931289Help
Entry
111931289         CDS       T05602                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00480  Glutathione metabolism
ccae00980  Metabolism of xenobiotics by cytochrome P450
ccae00982  Drug metabolism - cytochrome P450
ccae00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111931289 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    111931289 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    111931289 (GSTO1)
   00983 Drug metabolism - other enzymes
    111931289 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccae02000]
    111931289 (GSTO1)
Enzymes [BR:ccae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111931289 (GSTO1)
Transporters [BR:ccae02000]
 Other Transporters
  Pores ion channels [TC:1]
   111931289 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin Glutaredoxin2_C GST_N_4 LPD22
Motif
Other DBs
NCBI-GeneID: 111931289
NCBI-ProteinID: XP_023785585
LinkDB All DBs
Position
6
AA seq 242 aa AA seqDB search
MSGDHSRSLGKGSAAPGPVPAGLLRLYSMRFCPFAQRARLVLRAKDISHEVININLKNKP
DWYFEKNPSGLVPVLETSKGQLIWESPITCEYLDEAFPGKKLMPSDPYERACQRMLLEDF
SKITPLLFKHVLAVKDGQDTTALKAEIAEKFGKLEEVLSKRNTVFYGGDSISMVDYMIWP
WFERLEAFQLKDSLNHTPKLQRWMEAMKKDPAIKATITDPQTYKNYLQLYLQNSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgatcactcccgcagcctgggcaagggcagcgcggcgccgggccctgtgccc
gcggggctgctccggctctacagcatgcgcttctgccccttcgcgcagcgggcgcgcctg
gttctccgcgccaaggacatcagtcatgaagtaatcaacatcaatctgaagaataaacct
gactggtactttgagaagaacccctctgggctggttcctgttctggagaccagcaagggc
cagcttatctgggagtccccaatcacctgtgagtacttggatgaagcatttccagggaag
aagctgatgccttcagacccgtatgagcgagcctgtcagaggatgctcttggaagacttc
tcaaagataacacccttgcttttcaagcatgttttggcagtcaaagatggacaggacacc
actgcactgaaagcagagattgctgaaaagtttggcaagcttgaagaggttctgtccaaa
cgcaacacggtgttttatggtggggactcaatctcaatggttgactacatgatctggcca
tggtttgaacgtctggaagcattccagctgaaagactctttgaatcacaccccaaagctc
cagcgctggatggaggccatgaagaaggatccagctatcaaggctacaataactgaccca
cagacatacaaaaactacctccagctgtatctgcagaacagccctgaggcatgtgattat
gggctctga

DBGET integrated database retrieval system