KEGG   Cyanistes caeruleus (blue tit): 111931492Help
Entry
111931492         CDS       T05602                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00051  Fructose and mannose metabolism
ccae00052  Galactose metabolism
ccae00500  Starch and sucrose metabolism
ccae00520  Amino sugar and nucleotide sugar metabolism
ccae00524  Neomycin, kanamycin and gentamicin biosynthesis
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
ccae04910  Insulin signaling pathway
Module
ccae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111931492 (HK1)
   00051 Fructose and mannose metabolism
    111931492 (HK1)
   00052 Galactose metabolism
    111931492 (HK1)
   00500 Starch and sucrose metabolism
    111931492 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    111931492 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111931492 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111931492 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccae04131]
    111931492 (HK1)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111931492 (HK1)
Membrane trafficking [BR:ccae04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111931492 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 111931492
NCBI-ProteinID: XP_023785914
LinkDB All DBs
Position
6
AA seq 889 aa AA seqDB search
MRLSDETLLDVMARFRREMKNGLSRDFNPTAAVKMLPTFVRSIPDGSEKGDFIALDLGGS
YFRILRVKVSHEKKQTVQMESEIYNTPEDIMHGSGTRLFDHVAECLGDFMEKQQIKDKKL
PVGFTFSFPCRQTKLDEGILITWTKRFKASGVEGADVVRLLNKAIKKRGDYDADIMAVVN
DTVGTMMTCGFDDQRCEVGLIIGTGTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDG
SLEDIRTEFDREIDRGSLNPGKQLFEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPEL
LTKGKFETKHVSAIEKSKEGLNKAKEILTRLGVEPSPEDCIAVQHVCTIVSFRSANLVAS
TLGAILNQLRDNKGVGRLRTTVGVDGSLYKMHPQYARRLHKTTRRLVPDSEVRFLLSESG
SGKGAAMVTAVAYRLSEQHRLIDETLAEFKLTHEQLLQVKKRMRAEMEAGLKKKTHETAK
VKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQ
GTGEELFDHIVTCISDFLDYMGIKGARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDC
EGEDVVYLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYME
EMKNIEMVDGEQGRMCVNTEWGAFGDNGCLDDIRTTYDKAVDDFSLNAGKQRYEKMISGM
YLGEIVRNILIDFTKRGFLFRGQISETLKTRHIFETKFLSQIESDRLALLQVRTILQQLG
LNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAAIVDKIRENRGLERLEITVGVDGTLYKLH
PHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKGAALITAVGCRLREAEQN
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcggctttctgacgaaacgctgctggacgtcatggctcgcttcaggagagagatgaag
aacggcctctccagggattttaacccaacagccgcggtgaagatgcttcccacctttgtg
aggtccattcctgacggttcagaaaaaggagatttcattgctctggatctcggcggttct
tacttccgaattcttcgggtaaaggtatcgcatgaaaaaaagcagacggtgcagatggaa
agtgaaatttataataccccagaagacatcatgcatgggagtggaacacggctttttgat
catgttgctgaatgcctgggagactttatggagaaacaacaaatcaaagacaagaaactg
ccagtcgggtttacattctccttcccctgtcgacaaaccaagctagatgagggtattctg
ataacctggacgaagcgcttcaaagcgagcggagtggagggagcagatgtcgtgaggctg
cttaacaaggccatcaagaaacgtggggactacgatgcagatatcatggccgtggtcaac
gacaccgtggggaccatgatgacctgtggcttcgacgaccagcgctgcgaagtcggcttg
atcattggcaccggcaccaacgcctgctacatggaggagatgcggcacatcgacctggtg
gagggggacgagggcaggatgtgcatcaacaccgagtggggggccttcggagatgacggc
tcgctggaagacatcaggaccgagttcgatcgagagattgaccgtggatcccttaatcct
gggaagcagctgtttgagaagatggtcagtgggctgtacatgggggagctggtaaggctt
atcctggtgaagatggccaaggaggggctgctctttgaagggagaatcacccctgagctt
ctcaccaaagggaagtttgagacaaagcatgtttctgccattgaaaagagcaaagaaggt
ttgaacaaagccaaagaaatcctgacccggctgggggtggagccgtcccccgaggactgc
attgctgtccagcacgtctgcaccatcgtgtccttccgctcggccaacctggtggcctcc
accctgggcgccatcctcaaccagctgcgggataacaagggcgtgggccggctccggacc
accgtgggggtggatggctccctctacaagatgcacccacagtacgctcggcgcttgcac
aaaaccacgcggcgcctggtgccggactcggaggtgcggttcctgctgtcggagagcggc
agcgggaagggggcggccatggtgacggctgtggcgtaccggctgtcggagcagcaccgc
ctcatcgacgagaccctggccgagttcaagctcacccacgagcagctgctgcaggtgaag
aagaggatgagggcagagatggaagcggggctgaagaagaagactcacgagacggccaaa
gtgaaaatgctgcccaccttcgtccgcagtacgccggatgggacagagaatggagacttt
ctggcacttgaccttggaggaacaaactttagagttttgctggtgaaaatccgcagcggt
aaaaggagaacagttgagatgcacaacaagatctatgccattcccatagaggtgatgcag
ggaacaggagaagagctgtttgatcacatcgttacctgcatttctgacttcctggattat
atggggataaaaggcgctcgtcttcctcttggcttcaccttttccttcccctgcaagcag
accagcctggatgctggtatccttctcaattggacaaaaggcttcaaagctacagactgt
gagggagaagatgtggtatatttacttagagaaggaattaaaagaagagaggaatttgac
ttggatgtggtggctgtggtgaatgatacagtgggcacaatgatgacttgtgcttatgaa
gatccaaactgtgaaattgggctcattgtgggaacgggcagcaatgcctgctacatggag
gagatgaaaaacatagaaatggtggatggtgagcaagggcggatgtgtgtgaacacggag
tggggagcgttcggggacaacgggtgcctggacgacatcaggacaacatatgacaaggca
gtggatgacttctcactgaatgctggaaagcaaaggtatgagaaaatgatcagtgggatg
tacctaggggaaatagtccgcaatattttgatcgacttcaccaaacggggtttcctgttc
cgaggccagatttcagagacactgaagaccagacatatctttgaaaccaagttcctttct
cagattgagagtgacaggttagccttgctgcaggtgcgaaccatcctccagcagctgggg
ctcaacagcacctgcgacgacagtatcatcgtcaagacggtctgcggggcggtgtcgagg
cgagcagctcagctgtgtggcgctggaatggctgccattgtagataaaattagggagaac
agagggttagagcgcctggagataacggttggtgtggatggcactctctacaaactccac
ccacacttttcgaggatcatgcaccaaacagtcaaagacctggcacccaactgcgacgtg
accttcctgctgtcggaggacggcagcgggaaaggggcagcgctcatcacagcggtggga
tgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system