KEGG   Cyanistes caeruleus (blue tit): 111932098Help
Entry
111932098         CDS       T05602                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00250  Alanine, aspartate and glutamate metabolism
ccae00410  beta-Alanine metabolism
ccae00430  Taurine and hypotaurine metabolism
ccae00650  Butanoate metabolism
ccae01100  Metabolic pathways
Module
ccae_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111932098 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111932098 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111932098 (GAD1)
   00430 Taurine and hypotaurine metabolism
    111932098 (GAD1)
Enzymes [BR:ccae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111932098 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 111932098
NCBI-ProteinID: XP_023786793
LinkDB All DBs
Position
7
AA seq 590 aa AA seqDB search
MASSAPSSSNDAPDPTPPNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
SSLKERQSSKGLLACENSEKGSRFRRTETDFSNLYARDLLPSKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKEKGYVPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDSDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGEKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgctccctcgtcctccaacgatgctccggaccccaccccacctaatttg
cgacctacaacttacgactcgtggtgcggcgtggctcacgggtgcaccaggaagatcggg
ctgaagatatgcgggttcctgcaacggaccaacagcctggaagacaagggccggatcgtc
agttctctgaaggaaaggcagtcctccaagggcttgctggcatgcgagaacagtgagaaa
ggatccaggttccggcgcaccgagacagacttttccaatctgtatgccagagatctgctg
ccctccaagaatggtgaggagcagaccatgcagttcctgttggaggttgtggacatcctc
ctcaattacgtgaggaagacgtttgacagatccaccaaagtgctggacttccaccaccca
caccagctcctggagggcatggagggcttcaacctggagctgtcggacaaccctgagtcc
ctggagcagattctggtggattgtcgggacacactgaaatacggagtgaggacaggtcat
cctcgctttttcaatcagctgtccacaggactggacattattggcttggctggggagtgg
ctgacatctactgctaatacaaacatgtttacctatgaaattgcccctgtttttgtcctc
atggaacaaataacacttcgaaagatgagggagatcattggatggtcaaataaagatggt
gatgggatattctcacctggaggagcaatctccaacatgtacagcataatggctgcacgc
tacaaatattttcctgaagttaaaaccaaaggcatggctgcagtccctaaactggttctc
tttacctcagagcatagtcattactcaataaagaaagctggagctgcacttggatttgga
acagacaatgttattttgataaaatgcaatgaaagaggaaaaataataccagctgatttg
gaggcaaaaattctggaagcaaaagaaaagggatatgttcctctttttgtgaatgcaact
gcaggcacaacagtatatggagcctttgatccaatacaggagattgcagatatttgtgaa
aaatacaacctctggctccatgtagatgctgcctggggaggtggactcctaatgtcccga
aagcaccgtcataaactgaatggaatagaaagagccaactcagtcacttggaatccacac
aagatgatgggagtgttgttacaatgttctgcaattcttgtccgggagaagggtatcctt
caaggctgcaatcaaatgtgtgcaggctatctcttccagccagacaaacagtatgatgtt
tcctatgacactggagataaggcaatacagtgtggtcgacatgtggacattttcaaattc
tggttgatgtggaaagcaaagggtacagtaggatttgaaaatcaaatcaataaatgcctg
gaactggcagagtatctctacactaaaataaaaaacagagaagaatttgaaatggttttt
gaaggggagccagagcatacaaatgtatgtttttggtatattcctccaagtctcaggggc
atgccagactctgatgagagaagagaaaagttacacagggtggcaccgaaaatcaaggca
ctgatgatggagtcaggtaccaccatggttggatatcagcctcagggcgaaaaagtcaac
tttttccgaatggttatctcaaacccagcagcaactaagtctgacattgacttcctcatt
gaggaaattgagagattgggacaggagctgtag

DBGET integrated database retrieval system