KEGG   Cyanistes caeruleus (blue tit): 111932269
Entry
111932269         CDS       T05602                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04060  Cytokine-cytokine receptor interaction
ccae04068  FoxO signaling pathway
ccae04144  Endocytosis
ccae04218  Cellular senescence
ccae04350  TGF-beta signaling pathway
ccae04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111932269
   04350 TGF-beta signaling pathway
    111932269
   04068 FoxO signaling pathway
    111932269
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111932269
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111932269
  09143 Cell growth and death
   04218 Cellular senescence
    111932269
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111932269
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111932269
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111932269
Protein kinases [BR:ccae01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111932269
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal FixQ
Other DBs
NCBI-GeneID: 111932269
NCBI-ProteinID: XP_023787093
LinkDB
Position
7
AA seq 558 aa
MGSWRRPGLLALLLLSLSCGASARRSLKTNLCKWCDSTAPACEEKVCYSNCNLNSYCEDP
YEICVAIWRQDNESIRISTLCHNPHRPIENLMVPNYNTSRCIMSHQPSEDGVIYVCGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRRKRAK
AWGGKQGQPPALPEPGKATEREEKLSVLMDEGSAGTSPAELLPIELDEMVGKGQFAEVWR
AKLSHSRSGQYETVAVKIFPCEEYSSWKNESQIFTDTSLRHDSVLQFLTAEDRGTGPRRE
YWLITAYHSRGNLKDYLSRHVLSWMELQKMAGSLVSGVAHLHSDYTACGRPKIPIAHRDI
KSTNVLVKNEQECVLCDFGIAIRLDPSLTADDFANSGQVGTARYMAPEVLESRVNLEDLE
SFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLHGRGRPEI
PSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNNMDNEASK
TASPGGEHQDSDGSRNIQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggggtcctggaggagaccgggtctgctcgccttactgctgctctccttgtcctgcggt
gccagcgcccgccgcagcctcaagaccaacctgtgcaagtggtgtgattccacagctcca
gcctgcgaggagaaggtgtgctacagcaactgcaacctcaactcctactgcgaggacccc
tacgagatctgcgtggcaatatggagacaggacaacgagagcatcaggatcagcacgctg
tgccacaacccccaccgccccatcgaaaacctcatggtccccaactacaacacctcgcgc
tgcatcatgagccaccagcccagcgaggacggggtcatctatgtctgtggctgtgtggat
gagcaggagtgcaatgacaaactcatctttgaaaaccacaccaatggctactccatgctg
cagagcaaagaggtgatccccgtggctgccatcagcctcctgcccccgctgctggtggcg
gtgatgatcacggtgatattttacctttgccgcacgcagaagcgacgcaagagagccaag
gcgtggggtgggaaacagggccagcccccggcgctgccggagccggggaaggcgaccgag
cgggaggagaagttgtccgtgctgatggatgagggctcggccggcaccagccccgctgag
ctgctccccatcgagctggacgagatggtgggcaaagggcagttcgcggaggtgtggagg
gccaagctgagccacagccgctcggggcagtacgagaccgtggccgtgaagatcttcccc
tgcgaggaatactcctcctggaagaacgagagccagatcttcaccgacaccagcctcaga
cacgacagcgtcttgcagttcctcactgccgaggaccggggcacggggccccgccgggag
tactggctcatcaccgcctaccacagccggggcaacctcaaggactacctctcccgccac
gtgctgagctggatggagctgcagaagatggctgggtccctggtgagcggggtggcccat
cttcacagcgactacactgcctgcggccgcccgaaaatccccatcgcccaccgcgacatc
aagagcacaaacgtcctggtgaagaacgagcaggagtgtgtgctctgcgacttcggcatc
gccatacgcctcgacccctccctgacagcggatgactttgccaacagcgggcaggtgggc
actgccaggtacatggccccagaggtcctggagtccagagtgaacctggaagacctggag
tctttcaagcagatggatgtctactccatggccctcgttttgtgggaaatggcctccaga
tgtgaagtggtaggagaggtaaagaattatgagctgccttttgggtcaaaagtccaggag
cagccttgtgtggacaccatgagggacatcgtgctgcatggcagaggccggcccgagatc
ccaagcagctggctggtgcaccagggaatgcgtttcctgtgcgacaccatcacggagtgc
tgggaccatgaccctgaggctcggctcactgcccactgcgtggctgagcgcttcaacctg
atggcacagatggattgcgatgacatcctcaacaacaacatggacaatgaggccagcaaa
acagcttctccaggtggggagcaccaggacagtgatgggagcagaaacattcagtga

DBGET integrated database retrieval system