KEGG   Cyanistes caeruleus (blue tit): 111932522Help
Entry
111932522         CDS       T05602                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00590  Arachidonic acid metabolism
ccae01100  Metabolic pathways
ccae04370  VEGF signaling pathway
ccae04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111932522 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111932522 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111932522 (PTGS2)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     111932522 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 111932522
NCBI-ProteinID: XP_023787358
LinkDB All DBs
Position
8
AA seq 571 aa AA seqDB search
MSAGPDRYECDCTRTGYYGQNCTTPEFFTWLRLALKPSPNTVHYILTHYQAAWNIINNIP
FLRDTIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGLDCPTPMGIK
GKKELPDSNLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKRGPAFTRALGH
GVDLNHIYGETLERQLKLRLRKDGKLKYQMINGEMYPPTVRDTQAEMLYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDVLKHQHPDWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFRSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEMG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFDIVNTASLQKLICNNVKGCPFTAFHILPPE
PTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgggccagatcgctacgagtgcgactgcaccaggacaggctactacgggcag
aactgcaccacaccggaattcttcacgtggctgaggctagcactgaaaccatcaccaaac
actgtccactacatcctcacccactaccaagcagcctggaatatcatcaacaacattccc
ttcctacgggacactattatgagatatgtactaacttcaagatcacacttgattgacagc
ccaccaacttacaatagtgactacagttacaaaagctgggaagcttattccaatctttcc
tactacacgagaagccttccaccagtaggacttgactgcccaacaccaatgggtattaaa
ggcaagaaagagctcccagattcaaatctgattgtggagaagtttctgctgaggagaaag
tttattcctgacccgcaaggcacaaatgtgatgttcacattctttgcccagcacttcacc
caccagttcttcaagacggaccacaagcggggccctgccttcaccagagcgctcggccac
ggggttgacttgaaccacatttatggagagactctggagagacaacttaaactgaggctt
cgaaaggatggaaagctaaaataccagatgatcaatggagaaatgtacccgccgacggtg
cgggacacacaggcagagatgctgtacccgccccacgtgcctgagcacctgcagttctcc
gtggggcaggaggtgttcgggctggtgccagggctgatgatgtatgccacgatctggctg
cgcgagcacaaccgcgtctgcgatgtgctcaagcaccagcaccccgactgggacgacgag
cagcttttccagaccacccgtctcatactgataggagagacaatcaagatcgttatagag
gactatgtgcagcacctgagcgggtaccacttcaagctgaagtttgaccccgagctgctc
ttcaaccagaggttccaataccagaaccgcattgcagctgaattcaacaccctgtaccac
tggcacccactgctgcctgacaccttccagatccatgaccaggagtacaccttccagcag
ttcctgtacaacaactccatcatgctagagcatggactctcccatatggtcaaatctttc
tccaagcaaagtgctggcagggttgctggtgggaagaatgttcctgctgcagtacagaaa
gtggcaaaggcctccattgaccaaagcagacagatgaggtaccagtccttgaacgagtac
aggaaacgcttcatgctgaaaccattccgatccttcgaagagcttacaggagaaaaagag
atggcagcggagctggaggagctctacggggacattgatgccatggagctgtacccaggc
ctgctggtggagaagccccggcccggggccatctttggcgagaccatggtggaaatgggg
gcaccattctccctgaagggtctgatgggcaatgccatctgctcccctgagtactggaag
cccagcaccttcgggggcaaggtgggctttgacatcgtcaacacagcctccctgcagaag
ctcatctgcaacaacgtgaagggctgtcccttcactgccttccacatcctgcctcctgag
cccactgaggccacgattaatgttagtacctcaaaaactgccatggaagatatcaacccc
acgcttctgctgaaagagcgctctgccgagctgtag

DBGET integrated database retrieval system