KEGG   Cyanistes caeruleus (blue tit): 111932617
Entry
111932617         CDS       T05602                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111932617 (CACNA1E)
   04020 Calcium signaling pathway
    111932617 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccae04040]
    111932617 (CACNA1E)
Ion channels [BR:ccae04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111932617 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 111932617
NCBI-ProteinID: XP_023787523
LinkDB
Position
8
AA seq 2200 aa
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGC
PPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNSGTSALEVLRRATIKRNRTDAMSGDEHCVDIASVGERRLAQRRRLHPTLGNP
SSQSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQP
AWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFR
PGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLG
MQLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSI
YFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAP
NMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDE
PPLINPHASIFRRKRPGEGVTLEKCAEEQGKGERPLAEGPEQPVPGANPGGGEDRTSPRA
KRDKDMWQQKSCHGNCEPGEQDGAGGSAEERARMRQSQRRSRHRRTRMEGKDTAGILGSR
SASQEMGLEEACTAEGTQDGDRRGDVAATEALIPGDPEASGESIRTNGVPAGDADLIGTA
RKGSPPHAAAELSQGKTGNLTEQDCSSPDTSEQALLEHSRTVSRSEPDLSSITPNTEKAT
ESTAIMIDVHDSAVVQISNKTDGEASPLKEAETKEDEEEMEKKKRKKEKSETGKAMVPHS
SMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDY
VFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDI
KTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLF
KGKFFYCTDSSKDTQKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTG
EGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGD
KMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALN
TVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVI
GSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVC
LLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLS
CLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTR
DSSILGPHHLDEFVRIWAEYDRAACGRISYKDMYKLVRVISPPLGLGENCPYRVACKRLV
LMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKML
DLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEI
ISNAKALPYLQQDTLSGLSSRGGFPSLSPLSPQEIFQLACMDPAQEQFQEHQSLEPEVRE
FQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRPNSS
WLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSGHRSEGHRSGRERGRSKERKHLL
SPDISRCNSEERSPQAQEESPERRRESRSPSEGRSQTPSRQGMGSLSESSIPSISDTSTP
RRGRRQLPPVPPKPRPLLSYASMLRHAGDTSPPADESEGGSPLLSSTLDPNTAAPTESSS
SPAGKQSRQSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPL
RHSWQMPNGHYRRRRRGAAQGVMCGASIDVLSDTEEDDKC
NT seq 6603 nt   +upstreamnt  +downstreamnt
atgatcctggcgaccatcattgccaactgcatcgtgctggccctggagcagcacctcccc
gaggatgacaagacgcccatgtcacggagattagagaagacagagccctacttcattggg
attttctgcttcgaggctgggattaagatcgtggccctggggttcgttttccacaagggc
tcgtacctgcgcaacggctggaatgtcatggacttcatcgtggtcctcagcggcatcctc
gccacggccgggacacacttcaacacccacgtggacctgcggacgctgcgggccgtgcgc
gtgctcaggcctctgaagctcgtctcgggcattcccagcttgcagattgtcctgaaatcc
atcatgaaggccatggtgcctctcctccagatcggcctgctgctcttttttgctatcctc
atgtttgccatcatcggcctggagttctacagcgggaagctgcaccgagcctgctacaca
aacaattcaggtgaactagaggagctggaccctccccatccatgcggggtgcagggttgc
cccccgggctacgagtgccgggagtggatcggtcccaacgatgggatcacgcagtttgac
aacatcctctttgctgtgctgaccgtcttccagtgcatcaccatggaagggtggaccaca
gtcctgtacaataccaatgatgccttaggagccacctggaactggctgtacttcatcccc
ctcatcatcattggatccttctttgtcctcaaccttgtcctgggagtgctgtcaggggag
tttgccaaagagagagagcgcgtggagaaccgccgagccttcatgaagctgcggcgccag
cagcagatcgagcgggagctcaacggctaccgggcgtggatagacaaagcggaggaagtc
atgctggctgaagagaacaaaaattcggggacctcagccttagaagtgctcaggagagcc
accatcaagcggaacaggacggatgccatgtcgggtgacgagcactgtgtcgacatcgcc
tccgtgggcgagcggaggctagcgcagagacgacgtcttcatccaaccttgggtaacccc
tcgagtcagtctggcctcaaaggtgccagggtggacggtgcctcctacttacggcacaag
gagcgactcctgcgcatctccgttcgccacatggtgaaatcccaggtcttctactggatc
gtcctgagcctggtggctctcaacactgcctgcgtggccatcgtccatcacaaccagcca
gcctggctcacccacttcctctactatgcagagttcctgtttcttgggctcttccttctg
gagatgtccttaaagatgtacgggatggggccacgcctttacttccattcttccttcaac
tgcttcgactgtggggtcacagtgggaagcatcttcgaagtggtctgggctatattcaga
ccaggaacctcttttgggatcagtgtcctacgagctcttcgtctcctgcggatatttaaa
ataaccaagtactgggcatccctgaggaatttggtggtctcgctgatgagctccatgaaa
tctattatcagtctgctcttcctcctcttcctcttcattgtagtctttgccctgctggga
atgcagctgtttggaggcaggtttaacttcatggacgggactccatcagccaacttcgac
accttccctgcagccatcatgacggtgtttcagatcctgacgggcgaggactggaacgag
gtgatgtacaacggcatccgctcccagggaggcgtgcgctcagggatgtggtcctccatc
tacttcatcgtcctcaccttgtttggaaactatactctgctgaacgtcttcttggccatc
gccgtggacaacctggccaacgcccaggagctcaccaaggacgagcaggaggaagaggag
gcctttaaccagaagcacgcccttcagaaagccaaagaagtcagccccatgtctgcccca
aacatgcctgctatcgaaagagacaggcggaggagacaccacatgtcgatgtgggagcca
cgcagcagccacctgcgggagcgtcgccggcggcaccacatgtcggtgtgggagcagcgc
acgagccagctgcgccggcacatgcagatgtccagccaggagggcatcaacaaggatgag
ccacccctcatcaatccccacgccagcatcttccgcaggaagagacccggggaaggtgtc
accctggagaagtgcgctgaggagcagggcaagggcgagcggccgctggccgagggaccc
gagcagccggtcccaggagccaaccctggtggtggtgaggacaggacatcgccccgagcc
aagcgggacaaggacatgtggcagcagaaatcctgccatgggaactgtgagccgggagag
caggacggggcaggaggcagcgccgaggagagggcgaggatgaggcagagccagcggcgc
agccggcaccgcaggacccgcatggaggggaaggacactgctggcatcctggggagccgc
tcggccagccaggagatggggctggaggaggcctgcaccgccgaggggacgcaggacggc
gaccggcgcggggacgtggctgccaccgaggcgctgattccaggggatcccgaggcgagc
ggggagtccatcaggactaacggggtccctgccggcgatgccgatctgattgggaccgcc
aggaaggggagccccccgcacgccgcagccgagctctcccaggggaagacgggcaacctg
acggagcaggactgcagcagcccggacacgagcgagcaggcgctgctggagcacagccgc
accgtgagccgcagcgagcccgacctctcctccatcacccccaacaccgagaaggccacc
gagagcacggccatcatgatcgatgtgcacgactccgctgtggtacagattagcaacaag
acagacggcgaagccagccccttaaaggaggccgagaccaaagaggatgaggaagaaatg
gagaagaagaagaggaagaaggaaaagagcgagacaggcaaagcgatggtgccgcacagc
tccatgttcatcttcagcaccaccaacccggtgaggagggcctgccactacatcgtgaac
ctgcgctacttcgagatgtgcatcctcctggtgatcgccgccagcagcatcgccctcgcc
gccgaggatcccgtcctcaccaactccgaccgcaacaaagtgctgaggtatttcgactac
gtcttcaccggtgtcttcaccttcgagatggtgatcaagatgattgatcagggcttgatc
ctgcaggatggctcctacttccgagacctctggaacatcctggatttcatcgtggtggtg
ggagctctggtggcttttgccttggcgaatgctttggggaccaacaagggccgggatatc
aagaccatcaagtctctccgtgtgctgcgggtcttgaggcccctgaaaaccatcaagaga
ctgcccaagctgaaggccgtttttgactgtgtcgtgacatctctcaagaacgtcttcaat
atcctcattgtctacaagctcttcatgttcatcttcgccgtcatcgccgtgcagctcttc
aaggggaagttcttctactgcaccgacagctcgaaggacacgcagaaggactgcataggg
aactacgtggaccacgagaagaacaagatggaggtgaaatgccgggagtggaagcggcac
gagttccactatgacaacatcatctgggctctgctcaccctgttcaccgtgtccaccggc
gaggggtggccccaggtgctgcagcactcggtggatgtgacggaggaggaccgcgggccc
agccgcagcaaccgcatggagatgtccattttttatgtcgtctacttcgtggtcttccct
ttcttcttcgtcaacattttcgtggctctcatcatcatcacgttccaagagcaaggagac
aaaatgatggaggagtgcagcctggagaagaacgagagggcctgcattgactttgccatc
agcgccaagcccctgacgcggtacatgccccagaacagacacaccttccagtaccgcgtg
tggcacttcgtggtgtccccgtccttcgagtacaccatcatggccatgatagcgctcaac
actgtggtgctcatgatgaagtactattctgctccgtacacctacgagctggccctgaag
tacctgaacattgccttcaccatggtgttctccttggagtgcgtcctcaagatcatcgct
ttcggcttcctgaattatttccgggacacctggaacatcttcgacttcatcacggtcatc
ggcagcattacggagatcatcctgacggacaccaagctggtgaacaccagcagcttcaac
atgagcttcctgaagcttttccgggctgctcggctcatcaagctgctccgccagggttac
accatccgcatcctgctctggacctttgtgcagtccttcaaggcactcccctacgtctgc
ctgctgatcgccatgctcttcttcatctatgccatcattgggatgcaggtttttggcaat
atcaaactagatgaggaaagccacattaacaggcacaacaacttccgcagcttcctgggc
tccctcatgctcctcttcaggagtgccactggagaggcgtggcaggagatcatgctgtcc
tgcctggagggcaaaggctgcgagccggacacgacggcgacgtcggggcagaacgagaac
gagcgctgcggcactgacctggcctatgtttactttgtgtccttcatcttcttctgctcc
ttcctgatgctcaacctgtttgtggcagtcatcatggacaactttgaatacctgacacgg
gattcctccatcctgggccctcaccatctggatgagtttgtccggatctgggcagagtat
gaccgagcagcgtgcggcaggatctcgtataaggatatgtacaaattagtacgggtgatc
tcgcctcctctgggcctaggagagaactgcccctacagggtggcgtgcaagagactggtg
ctgatgaacatgcccgtggccgaggacatgacagtccacttcacctccaccctcatggcg
ctgatccgcacggccttggacatcaaaattgccaaaggtggtgcagattggcagcagttg
gactccgagcttcaaaaggagatcctgaccatttggcctcacctgtcccagaagatgctt
gacctgttggtacccatgccaaaaacctctgacctgactgttgggaaaatatatgcagcc
atgatgatcatggattactacaagcagagcaaggcgaagaagcagcggcagcagctggag
gagcagaaaaatgcccccatgttccagcgcatggagccgtcctctctgccgcaggagatc
atctccaatgccaaggctctgccgtacctgcagcaggacaccctctcgggcctgagcagc
cgaggcgggttcccctcgctgagcccgctctcgccacaggagatcttccagctggcgtgc
atggatccggcccaggagcagttccaggagcaccagtctctggagccagaggttagggag
tttcaaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcaggaccac
gctgtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtggtgaca
gacaccagctccatgaggagatcgttctccaccatccgggacaagcggcccaacagctcc
tggctggatgagttctccatggagcgcagcagcgacaacacctacaagtcccgccggcgc
agctaccactcctcgctccagctgtccgcccggcgcctcaacgctgactcgggccaccgg
tccgaggggcaccgctcgggcagggagcggggccgatccaaagagcgcaagcacctgctg
tcccctgacatctcccgctgcaactccgaggagaggagtccccaggcgcaggaggagtcg
ccggagcggcggcgcgagtcccggtcacccagcgagggcaggtcacagacacccagcagg
cagggcatgggctccctgagcgaaagctccatcccttccatctcggacaccagcacgccc
cgacgaggccgccgccagctgcccccggtgccccccaagccgcgtcccctcctgtcctac
gcctccatgctgcggcacgccggggacacctctcctccggccgacgagagcgaggggggc
tcaccgctgctctcctccactctggatcccaacacggccgctcccaccgagtcttccagc
tccccggcggggaagcagagccggcagtccacgccgcagcgctacatctcggagccctac
ctggcgcttcacgacgactcgcacgcctcagactgcggtgaggaggagacgctcaccttc
gaggcggccgtggccaccagcttgggccgctccaacaccatcggctcggcgccaccgctg
cggcacagctggcagatgcccaatgggcactaccgcaggcgacggcgaggagcggcgcaa
ggcgtcatgtgcggggccagcatcgacgtgctcagcgacaccgaggaagatgacaagtgc
tag

DBGET integrated database retrieval system