KEGG   Cyanistes caeruleus (blue tit): 111935800
Entry
111935800         CDS       T05602                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111935800 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111935800 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccae04052]
    111935800 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ccae00536]
    111935800 (FGF1)
Cytokines and growth factors [BR:ccae04052]
 Growth factors
  Growth factors (RTK binding)
   111935800 (FGF1)
Glycosaminoglycan binding proteins [BR:ccae00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111935800 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111935800
NCBI-ProteinID: XP_023792109
LinkDB
Position
13
AA seq 155 aa
MAEGEISTFSALTEKFDLPSGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGVVHIRSTQSGQYLAMDTKGLLYGSQLLGEECLFLERLEENHYNTYVSKLHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggaaatctccaccttcagcgccctgacggaaaaattcgacctcccctcg
ggcaactacaagaaacccaaactgctgtactgcagcaacggggggcatttcctgcgcatc
ctccccgacggcaccgtggatggcaccagggaccgcagcgaccagcacattcagctgcag
ctgagcgcggagagcgtgggggtggtgcacatcaggagcacgcagtcggggcagtacctg
gccatggacaccaaggggctgctctacggctcgcagttactgggtgaggagtgtctgttc
ctggaaaggctcgaagaaaaccattacaacacctacgtctccaaactgcacgcggacaag
aactggtttgtggggctgaagaagaacgggaacagcaagctgggcccgcggactcactac
ggccagaaggcgatcctcttcctgccactgcccgtctcagccgactga

DBGET integrated database retrieval system