KEGG   Cyanistes caeruleus (blue tit): 111935802
Entry
111935802         CDS       T05602                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111935802 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccae03000]
    111935802 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ccae03310]
    111935802 (NR3C1)
Transcription factors [BR:ccae03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111935802 (NR3C1)
Nuclear receptors [BR:ccae03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111935802 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 Gemini_AL2
Other DBs
NCBI-GeneID: 111935802
NCBI-ProteinID: XP_023792115
LinkDB
Position
13
AA seq 773 aa
MDSKELLNPSDRDETRKNALISTKGGIVMDFHPPFRGGATVQAPVSTSPLPASSQSDSSQ
QPALADFPKGLGNNVPQPDLSKAVSLSMGLYMGETDAKVMGNDLGFSHQGQIHISSGETD
FRLLEESIASLNKSSSLAEDAKGTASSEVPLEPDFPGMAGRSVPAESGAAVQSQVGSNGG
NLKLFSEDQSTLDILQDLELPPVSPGKEPNGSPWRLDPLLDDGGLLSPISADDAFLLEGS
LGEDCKPPLLSDTKPKINDRGDLLPSSKMPVPQVKTEKEDFIELCTPGIKQENLGPLYCQ
ANFSGSNLLGTKVSAISIHGVSTSGGQMYHYDLNTASLSQQQDQKPIFNIIPSLPAGSEN
WNRCQGSGDEALAPLGTLNLSGRPAFSNGYSSPGMRSDVSSSPSTTSATTGPPPKLCLVC
SDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQA
GMNLEARKTKKKIKGLQQGGVAGAREAPEAAGSKSIVPASLPQLTPTLVSLLEVIEPEVL
YSGYDSSLPDSSWRILSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLM
AFALGWRSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSYEEYL
CMKTLLLLSTIPKEGLKSQSLFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDS
MHDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggattccaaagaattgcttaacccgtcggatcgggacgaaaccaggaaaaatgcgctc
atcagtaccaaaggagggatcgtgatggacttccatccacccttcaggggtggagctact
gtccaagcccctgtgtctacatctcctctccctgcatcttctcagtcggattccagtcag
caacctgctttggctgactttccaaaaggattaggaaacaatgtgcctcagccagacctt
tccaaggcagtgtcgctctcgatgggactgtacatgggtgaaacagacgcaaaagtgatg
ggaaacgaccttggattttcgcaccagggccaaatccacatctcttctggagaaacggac
ttcaggctcctggaggaaagcatcgcgagcttgaacaagtcctcgagcctggccgaggac
gcgaagggaaccgcgtcttctgaggtgccgctcgagccggatttcccaggcatggctggg
cgcagcgtccccgcggagtcgggagctgcagtccaaagccaggtgggctcgaatggtggc
aacttgaagttgttctctgaagaccaaagcaccctggatatcctccaggatctggaattg
ccgccggtgtcgccgggcaaggagcccaacgggagcccgtggcggctggacccgttgctc
gatgacggtggcttgctctcccccatatccgcggacgacgcctttctcctggaaggaagt
ctcggcgaagactgcaagcctcctcttttatctgacactaaacctaaaattaatgaccgt
ggtgaccttttacccagttccaaaatgccagtgccgcaagtgaaaacagaaaaggaagac
ttcattgaactgtgtactcccggcatcaagcaggaaaacttgggcccgctttactgccag
gccaacttctccgggtcaaacctgctgggtacgaaagtctcggccatctccatccacggt
gtcagcacctctgggggacagatgtaccactatgatttaaatactgcgtcgctctctcag
cagcaggatcagaaaccaatttttaatatcattccatctcttcctgccgggtcagaaaat
tggaataggtgccagggatcgggggacgaggcattggctccgctgggaacgctcaacctc
tctggcagacctgctttctctaatggctattcaagccctggaatgaggtcagatgtaagc
tcttctccatccacaacctcagcaacgacgggaccacctcccaagctctgcctggtgtgc
tccgacgaggcctccgggtgccactacggtgtcctgacgtgtggcagctgcaaagtgttc
ttcaaacgggcagtggaagggcagcacaattacctgtgtgccggcaggaacgactgcatc
atcgacaagatccgcaggaagaactgccccgcgtgccgctaccgcaagtgtctgcaggct
ggcatgaacctggaagctcggaagacgaagaagaagatcaaggggctgcagcagggcggc
gtggcgggcgcgcgcgaggctccggaggcggccggcagcaagagcatcgtgcccgcgtcg
ctgccgcagctgacgcccaccctggtgtccctgctcgaggtcatcgagcccgaggtgctc
tactctggctacgacagctccctgcccgactccagctggaggatcctctccacgctcaac
atgctgggcggccgccaggtggtcgctgcggtcaagtgggcaaaggcgatcccaggtttc
cgaaatttgcacctggatgaccaaatgacccttctgcagtactcctggatgttcctgatg
gcttttgctttgggctggagatcctacaagcagtccaatggcaacctgctgtgctttgct
ccagacctgatcattaacgagcagaggatgaatctcccatgtatgtatgaacaatgcaaa
cacatgctcatggtggcccgagagctgtcccggctccaagtctcctacgaggagtatctc
tgcatgaagacgttgcttctcctctctacaattcccaaggaaggcctgaagagccagtcc
ctgtttgaggagatccgcatgacgtacatcaaggagctgggcaaggccatcgtcaagagg
gaagggaactccagccagaactggcagcgattttatcaactgactaaactgctggactct
atgcatgatgtggttgaaaatcttctgagcttttgcttccagacatttttggataaatcc
atgagtattgagttcccagaaatgttggcagaaatcatcagcaatcagataccaaaatat
tccaatggaaatatcaagaagctcttgtttcatcagaagtga

DBGET integrated database retrieval system