KEGG   Cyanistes caeruleus (blue tit): 111936492Help
Entry
111936492         CDS       T05602                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00512  Mucin type O-glycan biosynthesis
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    111936492 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccae01003]
    111936492 (GALNT9)
Enzymes [BR:ccae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     111936492 (GALNT9)
Glycosyltransferases [BR:ccae01003]
 O-Glycan biosynthesis
  Mucin-type
   111936492 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 111936492
NCBI-ProteinID: XP_023793238
LinkDB All DBs
Position
15
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSADRRARSRGAKVGSLAD
RESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQMTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIILVDDNSDNVELKFNLDQYVHKRYPGLVKIVRNNKREGLIRARIQGWKAATSP
VVGFFDAHVEFNIGWVEPALTRIKEDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MANPGVDFGDVSERIALRQRLQCRSFKWYLENVYPEMRVYNNTVTYGEVRNSKASGYCLD
QGAEEDDKAILYPCHGMSSQLVRYSSEGVLQLGPLGSTAFLPDSKCLVDDGKGRTPTLKK
CEDVLRPAQRFWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcacggaaaatcaaaactttgttgacggtgaacatcttggtcttcgtgggc
atcatcctcttctccgtctactgcaggatccaggaccgctcccaggagctggtgcagatc
gtccggagcgcggaccgccgggccaggagccgcggcgccaaggtgggcagcctggccgac
agggagtccatcctgcagcgcctggaccacctggaggaagtggtctacaaccagctcaat
ggtttggcaaagcccatgggattagttgaaggtccaggaggcttgggccaggggggaatg
gctgctaccctgagagatgatagccatgaatcagagactaagtatgaagaatatggttac
aatgcccagctcagcgacaggatatcgctggacaggtccatccctgactacagaccaaaa
aagtgcaagcagatgacctacccagacgacctgccccagatctctgtggtgtttatattt
gtgaacgaggctctctcggtcatcctgcgctcggtgcacagcgtggtgaaccacacccca
tcccacctgctcaaggagatcatcctggtggatgacaacagtgacaacgttgagctaaaa
tttaacctggaccagtatgtgcacaagaggtacccagggctggtgaaaatcgtgcgcaac
aacaaacgggaggggctgatccgagccaggatccagggctggaaagcagcaacctctcct
gtggtcgggttcttcgatgcccacgtggagttcaacattggctgggtggaacccgcgctt
acccggatcaaggaggatcgcaagcggatcatcctgcccgcgattgacaacatcaagtac
aacacgtttgaagtgcagcaatacgccaacgcagcccacggctacaactgggggctctgg
tgcatgtacataatcccaccacaggactggctcgataaaggggatgagtcagctcccatc
aggacaccagccatgatcggatgctcttttgtggtggaccgagagtattttggagagatt
ggcctgcttgaccctggcatggaggtgtatggaggagaaaacatcgagttaggcatgcga
gtgtggcagtgcgggggcagcatggaggtgctgccctgctcccgcgtggcgcacatcgag
cgcaccaagaagccctacaacaacgacatcgactactatgcaaagcgcaacgccctgcgc
gccgccgaggtctggatggatgacttcaagtcgcacgtttacatggcctggaacatcccc
atggcaaaccccggagttgactttggagacgtttctgaaagaattgctctgcgacagcgt
ctgcagtgccggagctttaagtggtacttggagaacgtgtaccctgagatgagggtttac
aataacacagtcacttacggagaggtgcgcaacagcaaagccagcggctactgcctggac
cagggggccgaagaggatgacaaagccatcctttatccatgccatggaatgtcctcccag
ctcgtccgctacagctcggaaggtgtcctgcagctggggccgctgggctccaccgccttc
ctgcccgactccaaatgcctggtggacgatggcaagggcaggacacccaccctcaagaag
tgtgaagatgtcctgaggccagcacagaggttctgggatttcacacagaatggtccaatc
attagcagagacactggccgctgtctagaagtggaaatgtcaaaggatgcaaattttggg
ctcagattagtggtacaaaggtgctcggggcagaaatggatgattagaaactggatcaaa
catggtcggcactga

DBGET integrated database retrieval system