KEGG   Cyanistes caeruleus (blue tit): 111937356Help
Entry
111937356         CDS       T05602                                 

Gene name
CACNA1G
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G isoform X1
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111937356 (CACNA1G)
   04020 Calcium signaling pathway
    111937356 (CACNA1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccae04040]
    111937356 (CACNA1G)
Ion channels [BR:ccae04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111937356 (CACNA1G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel SieB
Motif
Other DBs
NCBI-GeneID: 111937356
NCBI-ProteinID: XP_023794447
LinkDB All DBs
Position
18
AA seq 2364 aa AA seqDB search
MLVILLNCVTLGMFHPCEDIACDSPRCRILQSFDDFIFAFFAVEMIVKMIALGIFGKKCY
LGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPSMRILVTLLLDT
LPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSIPYTVDLERYYQTENEDEN
PFICSQPRENGMRYCRSIPTRREEGLECTLDYYSYNDTTNTSCVNWNQYYTNCSAGEHNP
FKGAINFDNIGYAWIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLC
LVVIATQFSETKQRESQLMKEQRVRYLSNASTLASFSEPGSCYDELLKYLVYIARKGSKQ
LVKAYRAAGVRMGFLSSPTSKAGAEQHGRKRQSRKRSSVHHLIHHHHHHHHHYHLGNGNL
RAPRASPEISDVETSSLHNGTNRLMLPPSAPNSLGAPSASPSNTESVHSIYHADCHFEPV
RCRSSLTQPSLGLPSPEGIPKNVVGSKVYPTVHSSTSHEMLKEKNLGEAAVGAGSSTLTS
LNIPPGPYSTMHKLLETQSAGFFSVHVTEKGDGFPGPCQSSCKISSPCTKLDGGSCTPES
CPYCLTVLAGEAELSDNETANSDSEGVYEFTQDAHYRDQRDPQRGRTGARRAHLALAFWR
VVCETFQKIVDSKYFGRGIMVAILINTLSMGIEYHEQPEELTNALEISNIVFTSLFALEM
LLKVLVYGPFGYIKNPYNIFDGIIVVISVWEIVGQQGGGLSVLRTFRLMRVLKLVRFMPA
LQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTLPDRKNFDSLL
WAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLVAILVEGFQTE
EISKREEASGQLSCIQLPVNSSGKGKLGVQEQGDASKSDSEGDLFPRSLEEEGELKKNLS
NPALMALSDHPELKTSLTPPLIIHTAATPMPMPKNAVFGDGAQGYESRRASGVSTEPVAT
YELKSPPSTRSSPHSPWRASSSWNSRRSSWNSIGRAPSLKRRGQSGERRSLLSGEGNESS
EEGDSSDEEHSSRAGSFNGSLPHRMESLETKGSFDLQDTLQVPSLHRTSSMHSTRTSVSE
HQDCNGRSSPGLLLRQLHLDEPHQDGDDGDDEGNMSKRDRMKAWVQARLPTCCKERDSWS
IYIFPPHSRFRLMCNKIITHKMFDHVVLVIIFLNCITIAMERPKIEPHSAERIFLTLSNY
IFTVIFLTEMTVKVVALGLCFGDKAYLKSSWNVLDGVLVLISVIDILVSMVSDSGTKILG
MLRVLRLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFK
GKFFVCQGEDTRNITNKSDCTEASYKWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDG
LDAVGVDQQPVMNYNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEAKRR
EEKRLRRLEKKRRNLMLDDVLMESSASAVQEAQCKPYYSDYSRFRLLIHQMCTSHYLDLF
ITGVIGLNVITMAMEHYQQPKVLDEALKICNYIFTIIFVLESVFKLIAFGFRRFFQDRWN
QLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTV
MQALPQVGNLGLLFMLLFFIFAALGVELFGDLECDDTHPCEGLGRHATFRNFGMAFLTLF
RVSTGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEE
SNKEAKEEAELEAELEMEMKTIIPSQHSPSDIFAWTGTTSGERPESPHRFTNPMQIKVDS
QLSLAYHMERHLFDTISLLIQESLEGELKLMDNLSGSVCHHYALPAPEYYNSENQIPLAE
MEALSLTSDILSEKSWSLALTDDSFADDINTHLLNALESNADLRSKDDTLTLSPSKDLLS
VRKPSVGRTHSLPNDSYMFQPPYSSPCPASLGDRKPAHHKSQSGSKASVQSQPADTSSLL
QIPKEHFHHVRAHDHLVGDSKPRVSQQAHSPSAERLLRRQMAIRNDSLDSKENLHTEVSE
LSDPNVPTVPKEESPVALMPSEVNELAAWSRASVHTQQHSHNQYNISKQAPASCACADSY
QETPEDSMDQEVSEINSSSEPFTSETCTASSACSEGQPLTSKRNMGNTGNVVLKDLKKYH
SVDTQGLLKKPPSWLDDQRRHSIEICSIENSPQHHSTSSSSGFISQVVSEMECLQGTRQK
KKLSPPCISIDPPDGQSLVPRGPHSISPASGNVFLRRRAPSCESKDSMDIGDSLLPDTMS
ASPTPKKDLLTLPSFSFDQTEMDP
NT seq 7095 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgatcctgctcaactgtgtgacgctgggcatgttccacccctgcgaggacatc
gcctgcgactcgccacgctgcaggatactccagagctttgatgacttcatctttgccttc
tttgctgtggaaatgatcgtcaaaatgattgcgctggggatttttgggaagaaatgctac
ctgggagacacatggaaccgcctggacttcttcatcgtcattgcagggatgctggagtat
tccctggacctgcagaatgtcagcttctcagccgtccgcaccgtccgagtcctgcggcca
ctcagggccattaacagggtccccagtatgcgcatcctggtgacgctgcttttggacaca
ctgcccatgctggggaatgtcctcctcctctgcttctttgtcttcttcatctttggcatt
gtgggagtccagctgtgggcaggtttgctcaggaaccgctgcttcctccctgagaacttc
agcatcccctacacagtggatttggagaggtactaccagacagagaatgaggatgaaaat
cccttcatctgctcgcagccccgggagaacgggatgcgctactgtcggagcatcccgacg
cggagggaggagggtctggagtgcaccctggattattactcctacaatgacaccaccaac
acgtcttgtgtgaactggaaccagtactacaccaactgctctgctggggagcacaacccc
ttcaagggagccatcaacttcgataacattggctatgcctggattgcgatatttcaggtc
atcacgctggaaggctgggtggacatcatgtactttgtcatggatgcacactccttctac
aacttcatctacttcatcctcctgatcattgtgggctccttcttcatgatcaacctgtgc
ctggtggtgatagcgacgcagttctccgagacaaagcagcgggagagccagctgatgaag
gagcagcgcgtgcgctacctgtccaacgccagtaccctggccagtttctcagagccgggc
agctgctacgacgagctcctcaagtacctggtttacattgcccggaaaggcagcaagcag
ctggtgaaggcctacagggcggcaggcgtgaggatgggcttcctcagcagccccacgagc
aaggcgggtgccgagcagcatggcaggaagcgccagagcaggaagagatcctcggtgcac
cacctcatccaccaccaccaccaccaccaccaccactaccacctgggcaatgggaacctg
cgagcgccccgtgccagcccggagatcagtgatgtggagaccagctcgctccacaacggg
accaaccggctgatgctccctccctcggcacccaactccctgggggcccccagtgcctct
cccagcaacaccgagtccgtgcacagcatctaccacgccgactgtcactttgagccggtg
cgctgccggtcatccctgacacagccgagccttggcttgccgagcccagaagggatcccc
aaaaacgtggtgggcagcaaggtgtaccccacagtgcactccagcacctcccatgagatg
ctgaaagagaagaacctgggggaggcggcagtgggtgctgggagcagcaccttgacgagc
ctcaacatcccgcccgggccctacagcaccatgcacaagctgctggagacacagagcgca
gggttcttttcagtccatgttacagagaaaggcgatgggtttccaggtccctgccaaagc
tcttgcaagatctccagcccttgcaccaagctggatggtggctcctgcactcctgagagc
tgtccttactgcctcacggtgctggcaggcgaggccgagctgtcggacaatgagacggcc
aactcagacagtgagggagtgtacgagttcacacaggatgcccactacagggaccagcgg
gacccacaaaggggcagaaccggggccaggagagcccacctggcgctggccttctggcgt
gtggtgtgtgagaccttccagaagatcgtggacagcaaatatttcggccgtgggatcatg
gtggccattctcattaacacgctcagcatggggatcgagtaccacgaacagccagaggaa
cttaccaatgccctggagatcagcaacattgtcttcacaagcctctttgccctggagatg
ctgttgaaagtccttgtttatggtccttttggctacattaagaatccatacaacatcttt
gatgggatcattgtggtgattagcgtgtgggagattgtgggccagcagggcgggggcctc
tccgtgctgcgcacctttcgtctgatgcgggtgttgaagctggtccgcttcatgccagcc
ctgcagcgccagctcgttgtcctcatgaagaccatggacaacgtggccaccttctgcatg
ttgctgatgctcttcattttcatctttagcatcctgggcatgcacctctttggctgtaag
ttcgcttcggagcgcgatggtgacactctgcccgacaggaagaacttcgactccttgctc
tgggccatcgtcactgttttccagattttgacccaggaagactggaacaaggtcctttac
aatggcatggcctccacctcctcgtgggctgctctctacttcatcgctctcatgacattt
gggaattacgtcctctttaatctgctggtggccatcctggtagagggtttccagacagag
gagatctccaagcgagaagaagcgagtgggcagttaagctgtattcagctgcctgtcaac
tcgtcggggaaaggcaaactgggagtacaagaacagggtgatgcttccaagtctgattcc
gagggggatctcttcccccgcagcctggaagaggagggagaacttaagaaaaacttgtca
aatccagccttgatggccttgagcgaccacccggagctgaagacgagtctgacgcctccg
ctcatcatccacacggccgctacgcccatgcccatgccgaagaacgccgtgttcggggat
ggagcacagggctacgagtcccgccgggccagcggtgtctccacggagcccgtggccacc
tacgagctcaagtccccgcccagcacccgcagctccccgcacagcccctggcgtgccagc
agctcctggaacagccgccgctccagctggaacagcatcggccgggcccccagcctcaag
cgccggggacagagcggcgagcgccggtcgctcctgtcgggggaaggcaacgagagctcg
gaggaaggggacagctcggatgaggagcactccagccgggccggcagcttcaatggctct
ttgcctcaccgcatggagtctctggaaacaaaagggtcctttgacctgcaggatactttg
caggtgccttccctgcaccgcaccagcagcatgcacagcaccaggacgtctgtctccgag
caccaggactgcaatggcaggagctccccgggtctgctgctgcgccagctccacctggat
gagccccaccaggatggggatgacggcgatgatgaaggcaacatgagcaaaagggaccgc
atgaaggcctgggtgcaggcccggctccccacctgctgcaaagagagggactcctggtcc
atctacatcttcccccctcactccagattccgtctgatgtgcaataaaatcatcactcac
aagatgtttgatcacgttgtcttggtgatcattttcctgaactgcatcaccattgccatg
gaacgacccaaaattgagcctcacagcgctgaacggatcttcctaactctctccaactac
atctttacagtaatcttcctgactgagatgacagttaaggtggtggcactaggcttgtgt
tttggggacaaagcctacttgaagagcagctggaatgtgctggatggggtgctggtgctc
atctccgtcatcgacatcctggtctcgatggtgtcggacagcggcacaaaaatcctgggg
atgctgcgggttctgaggctgctgaggactctgcggcccttgagagtcattagtcgagcc
caaggactgaagctggtggtggagactctcatgtcatccttgaaacccattgggaacatt
gtggtcatctgctgtgcctttttcataatctttgggatcttgggagttcagcttttcaaa
ggcaagttttttgtctgccagggggaggacaccagaaacatcacaaataaatcggattgt
acagaagcaagctacaaatgggtccggcacaagtataattttgataatctcggacaggcc
ctgatgtctctctttgtcctggcctccaaggatgggtgggtggatatcatgtacgatggc
ttggatgctgtgggagtcgaccagcagccagtcatgaactacaatccatggatgctactc
tacttcatttccttcttgctgattgtggccttcttcgtcctcaatatgtttgtgggagtg
gtggtggagaatttccacaagtgtcggcagcaccaggaggaggaagaagccaagaggcgg
gaggagaagaggctccgccggctggagaaaaagagaaggaatctaatgctggatgatgta
ttaatggagagctcagccagtgcagtgcaagaagctcagtgtaagccctactactcggat
tactcccgtttccgcctcctgatccaccagatgtgcaccagccactacctggatctgttc
atcaccggcgtcatcggcctcaacgtcatcaccatggccatggagcactaccagcagcca
aaggttcttgacgaagccctgaagatttgcaattacatcttcaccattatttttgtcctg
gaatctgttttcaagcttattgccttcgggtttcgccgcttcttccaagacagatggaac
caattagatctggcaattgtgctgctgtctatcatgggcatcactttggaagagatcgag
gtgaacgcttcactgccaattaaccccaccattatccggatcatgagggttctcaggatt
gctcgagtgctgaagttgctgaagatggctgtggggatgagggccctcctggacactgtg
atgcaagcactgccgcaggtggggaatctgggccttctcttcatgttgttgtttttcata
tttgcagctcttggagtggagttgtttggtgacctcgagtgtgatgacacacacccctgc
gaggggctgggacggcatgccacattcaggaactttgggatggccttcctgaccctcttc
cgagtgtccacaggagacaactggaatgggataatgaaggacacgttgcgtgactgtgac
caggagtccacctgttacaacaccgtcatttcccccatctacttcgtctccttcgtgctc
acagcccagtttgtcctggtgaacgtggtgatcgctgtgctcatgaagcacttggaggag
agcaacaaggaggcaaaggaggaggcagagctcgaagcagaactggagatggagatgaag
accatcatccccagccagcacagcccctcagacatctttgcgtggacaggcaccaccagt
ggagagagacccgagagcccccacagattcaccaatcccatgcaaatcaaggtggattct
cagctctcactagcttatcatatggaaaggcacttgtttgataccatatcactgctgatc
caggaatctctggaaggagagctgaagctgatggacaacctgtcaggctctgtgtgccat
cattatgccctcccagctcccgaatattacaactctgagaaccagatccctctagctgag
atggaggctctgtctctgacgtcagatattctctctgaaaagtcctggtccttagctctg
acggatgactcttttgctgatgacattaacacacacttacttaatgctctggaaagcaat
gctgatctccgctccaaggatgacacactgaccctgtcccccagcaaggacctgctgagt
gtgaggaagccctcggtgggacgcacccactccttgccaaacgacagctacatgttccag
ccgccctactccagcccctgccctgcttccctgggtgacaggaagccagcacatcacaaa
tcccaatcaggttcaaaggcatcggtgcagtcacagccagcagacaccagctccctccta
caaatcccaaaggaacatttccaccatgtaagagctcatgaccatttggtgggggacagc
aagccccgggtctcccagcaggcacactccccttctgctgaaaggctgctccgcagacag
atggctataaggaacgactctctggatagcaaggagaatctccacaccgaggtgagtgaa
ctctctgacccaaatgttcccactgtgcccaaggaggagtcaccagtggctctgatgccc
tcagaagtgaatgagctggctgcctggagtcgggcgagcgtccatacgcagcagcattcc
cacaatcagtataatatttcaaagcaggcaccagcatcctgtgcttgtgcagactcgtat
caggagacccctgaagattcaatggaccaagaagtgtctgaaataaacagctcctcagag
cctttcacttcagaaacttgcacagcctcgagtgcctgttcagagggtcagcctctcaca
tctaagaggaacatgggcaataccggcaacgtggtactgaaggacctgaagaaataccac
agtgtagacacccagggtctgctaaaaaaaccaccctcttggttagatgatcaaaggaga
cattccatagagatttgttccatagaaaacagccctcagcaccattccacatccagctcc
tctggctttataagtcaggtggtcagtgaaatggagtgcttgcaaggtacgcggcagaag
aagaaactgagccctccctgtatatctatagatccacctgacgggcagagtttggtacct
aggggaccccacagcatctcacctgccagtggaaacgttttcttgaggaggcgtgctcca
tcctgtgagtccaaggattccatggatataggggattcactgcttccagacactatgtca
gcatctcctaccccaaagaaagacttgttgacacttcctagcttttcctttgatcaaacg
gaaatggacccctga

DBGET integrated database retrieval system