KEGG   Cyanistes caeruleus (blue tit): 111937682
Entry
111937682         CDS       T05602                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111937682 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111937682 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccae04052]
    111937682 (KITLG)
Cytokines and growth factors [BR:ccae04052]
 Growth factors
  Growth factors (RTK binding)
   111937682 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 111937682
NCBI-ProteinID: XP_023794897
LinkDB
Position
1
AA seq 298 aa
MEVVSLVQLTKPSVPVPKTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNL
PNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDIPDMSDVLSNYSIINNL
TRIINDLMACLAFDKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADGLDKNDC
ILPSTVGTPENDSRVAVTKTFLFPPVAASSLRNDSIGSSTNSNKEALGFISSSSLQGISI
ALTSLLSLLIGFILGAIYWKKIHPKSRPESDETTQCHDYQEENEISVLQQKEKEHLQV
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaggttgtcagcctggtacaactgactaagccatcagtgccagtgccaaagacttgg
attatcacttgcttttgtcttcaactactcctacttaatcctcttgtcaaagcccagagt
tcctgcgggaatccagtcacagatgatgtgaatgacattgcaaaattggttggaaatctc
ccaaatgattatctgataacccttaaatatgtcccgaagatggatagtctgcctaatcac
tgttggttgcatttgatggtgcctgagttttcaaggagtctacataatcttctccagaaa
ttttcagatattccagatatgtcggatgttttaagcaactattcaatcatcaacaatctc
acaaggataattaatgatcttatggcatgccttgcttttgataaaaacaaggattttgta
aaagaaaatggtcacctttatgaagaaggtcacttcattcctgaggacttttttaggcac
tttaatagtaccattgaggtctacaaagagtctgcagacggattggataagaatgactgc
attctgccttcaacagtaggaacaccggaaaatgattccagagtcgctgtcacaaaaaca
tttttgtttcctcctgttgctgccagctctcttaggaatgacagcattggcagtagcact
aacagtaacaaagaagcacttggcttcattagcagctccagcctgcaagggatcagcata
gctctgacatcattgctgtctctccttattggctttattttgggagcaatatactggaag
aaaatacatcccaaatccagaccagaaagtgatgaaactacacagtgtcatgactatcaa
gaggaaaatgagataagtgtgttgcagcaaaaagaaaaggaacatctacaagtgtag

DBGET integrated database retrieval system