KEGG   Cyanistes caeruleus (blue tit): 111937881
Entry
111937881         CDS       T05602                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00220  Arginine biosynthesis
ccae00330  Arginine and proline metabolism
ccae01100  Metabolic pathways
ccae04020  Calcium signaling pathway
ccae04146  Peroxisome
ccae04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111937881 (NOS2)
   00330 Arginine and proline metabolism
    111937881 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111937881 (NOS2)
   04020 Calcium signaling pathway
    111937881 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111937881 (NOS2)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111937881 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 111937881
NCBI-ProteinID: XP_023795183
LinkDB
Position
19
AA seq 1148 aa
MLCPWQFVFKSHATKNQYPREKDINNNAEKNRKIHGSSEKADAKLHAPSKKQMEGLPIVT
SAKPSEGRENLPPNDIKVSNQVSGCPRHVKVRNLENGSSFLDTLHLTAKEVISCRTKACQ
GSVMTPKGLVRGTRDGPVPLEDLLPQAVDFLKQYYSSFKEPKIKEHLGRLETVTKEIETT
GTYHLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVLDARDCKTAKEMFEHICRHIQYATN
NGNIRSAITVFPQRTDGQHDFRVWNSQLIRYAGYQMPDGSVLGDPATVEFTQLCTKLGWK
PKYGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYEWFRELDLKWYALPAVASML
LEVGGLEFTACPFNGWYMGTEIGVRDFCDAQRYNILKEVGRRMGLETNKLSSLWKDRAVV
EINVAVLHSFQKQNVTIMDHHSASESFLKYMQSEYRVRGGCPADWVWIVPPMSGSITPVF
HQEMLNYVLTPFYYYQVDAWKTHVWHDEARRPRKKEIRFSILAKAVLFASSLMQGAVATR
AKVTVIYATETGKSETLANNLCSLFSCAFSTKILCMDEYNICDLEKETLLLVVTSTFGNG
DSPGNGKTLKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASQLTPV
GEGDELNGQEEAFRSWAISAFKTACDIFNIRGRHSIQLPEIYSSEESWDPTNYRLVHDSQ
PMDLAKALASIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLHCETNQEVHYLPGEHIGIF
PGNQAELVHGIIARVKDAPPADQTIRLETCIDGGYWTSHKKVPACTLPEALTYLLDITTP
PSQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEISTAFL
LTQLPFLKPRYYSVSSSCDMTAREIHLTVAVVNYRTRDGKGPLHHGVCSTWLNTIELNET
VPCFIRSANDFHLPEEPARPCILIGSGTGIAPFRSFWLQRLYDLEHRGLRGGDMTLLFGC
RQPDVDHIYREETEEMKRKGVLRDVYTAYSRLPGQDKVYVQDILQRQLEARVCEVLQVQQ
GHIYVCGDVRMARDVARALQALLARALRLSQQQANEYFQQLKSQKRYHEDIFGAVFPHEV
KRALQPSS
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgtgttcaaatctcatgccaccaagaaccagtaccccaga
gagaaagatatcaacaacaacgcggagaaaaataggaagatccatggaagctcagaaaag
gctgatgccaaattgcatgctccaagcaagaagcagatggaggggctgcctatcgtaact
tcagcaaagcccagtgagggaagagagaatctccctccaaatgacatcaaagtttcaaac
caagtatcaggatgtccaagacatgtaaaagtaagaaatttggaaaatggatccagcttt
cttgacacattacacctgactgcaaaagaggttatcagctgccggaccaaagcctgccaa
gggtcagtcatgaccccaaagggcctggtgagaggtaccagagatgggccagttccactg
gaagatcttttacctcaggcagtagacttcctcaagcagtactacagttcctttaaagag
ccaaaaatcaaagagcatctgggccggctggaaacagtgaccaaggagatagaaacaaca
ggaacctaccacctgacaaaggatgagctgatctttgctgccaagcaggcctggaggaac
gcgcccaggtgcattggaagaatccagtggtccaatctgcaggtgcttgatgcacgggac
tgtaaaacagccaaggaaatgtttgaacatatctgtcgtcatattcagtatgccacaaat
aatggtaatataaggtcagccatcacggtgttcccgcagaggacggatgggcagcacgat
ttccgtgtgtggaacagccagctgatccgctacgctggctaccaaatgccagatggctct
gtccttggagaccctgccactgtggagttcactcagttgtgcaccaagcttgggtggaag
ccgaaatatggccgctttgatgtacttccacttgttctccaagcaaatggccaagaccca
gaaatatttgaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtac
gagtggtttagggagctggacctgaagtggtatgcactgcctgctgtggccagcatgctg
ctggaggtgggagggctggagttcaccgcctgtcccttcaatggctggtacatggggaca
gagattggagtgcgggacttctgtgacgctcagcgctacaacatcctgaaggaggtgggg
aggagaatgggactggaaacaaacaaactctcatcattatggaaggaccgagctgttgta
gagatcaatgtggctgtgcttcacagcttccagaaacagaatgtaaccatcatggatcac
cactcggcctccgagtccttcctgaagtacatgcagagcgagtaccgtgtgcggggtggc
tgcccggcagactgggtgtggattgtgcctcccatgtcaggcagcataacccctgtgttc
caccaagagatgctgaactatgtcctcactcccttctattactaccaggtggatgcatgg
aaaacacatgtgtggcatgatgaggcccgcaggccaaggaaaaaagaaataaggtttagc
atcttggcaaaggctgtgctctttgcatcctcacttatgcaaggagcagtggccacgagg
gccaaggtcactgtgatctatgccacagagacgggcaagtcagagacgctcgccaataac
ctgtgcagcctgttcagctgtgccttcagcactaagattctgtgcatggatgagtacaat
atttgtgacctggaaaaagaaacacttcttttagtggttactagcacttttggaaatgga
gattctccaggtaacggaaagaccttgaaggactccttgctcagactgaaactgctgaga
aataaaattagatatgctgtgtttggtctgggatccagcatgtacccagagttctgtgcc
tttgctcatgccattgaccaaaaactggcccaactcggggcttcccagctcactccagtg
ggtgaaggggatgaactcaatgggcaagaagaagctttccgcagctgggcaatcagtgct
ttcaagactgcctgtgacatttttaacatccgtgggagacacagtattcagttgcctgag
atctacagctctgaggaaagctgggaccctactaattacaggctagtgcacgactcccag
cccatggacctcgctaaagctcttgcaagcattcatgccaaggatgtaattcccatgaag
ctgaagttcaggcagaatcttcaaagtttgaagtccagtcgcgttaccattctggttaaa
cttcactgtgagactaaccaggaagtgcattaccttcctggggagcacattgggattttc
ccaggcaaccaggcagagttagtccatggcattattgcacgtgtcaaggatgcccctcca
gctgaccagactatcaggcttgaaacctgcattgatggtggatactggacaagtcataaa
aaggttccagcctgcacactacctgaggctttgacatacttgcttgatattactactcca
ccctcccaacaactgctaaaaaaactctcccagctggtgacagcagaaggagacaagcaa
aggctggaggtgttgtgtcagagcacagaagaatacaataaatggaagttttacaacagc
ccgaacatcctggaggtcctggaggaattcccctctgctgagatctccacagctttcctg
ctgactcagctgccatttctgaagcccaggtactattctgtcagctcatcctgtgacatg
acagccagagagattcatctgacagttgcagttgtaaactacaggacaagagatggcaaa
gggcctttgcaccatggagtctgcagcacatggctgaacacaatagagctcaatgaaacc
gttccctgcttcatccgcagtgctaatgacttccacctgccggaggagcccgccaggccc
tgcattctgatcggctcgggcaccgggatcgctcccttcaggagcttctggctgcagcgc
ctctatgacctggagcacagagggctcaggggaggggacatgacgctgctgttcggctgc
cggcagccagacgtggatcacatctacagagaggaaactgaggaaatgaagaggaaggga
gtcctgagagatgtctacacagcttactctagactgcctggccaagacaaagtgtatgtg
caggacatcctgcagaggcagctggaggcccgcgtgtgcgaggtgctgcaggtgcagcag
ggccacatctacgtgtgcggggacgtgcgcatggcgcgggacgtggcgcgggcgctgcag
gcgctgctcgcccgggccctgcgcctcagccagcagcaggcaaacgagtacttccagcag
ctcaagagccaaaagcgataccatgaagatatatttggggctgtgttcccacatgaagtc
aaaagagctttgcaacccagcagctga

DBGET integrated database retrieval system