KEGG   Cyanistes caeruleus (blue tit): 111938517Help
Entry
111938517         CDS       T05602                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00020  Citrate cycle (TCA cycle)
ccae00190  Oxidative phosphorylation
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111938517 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111938517 (SDHB)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111938517 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 111938517
NCBI-ProteinID: XP_023796036
LinkDB All DBs
Position
21
AA seq 280 aa AA seqDB search
MAAAAVGVSLRRGVPGRLLRAGPRAVLREAQTAAAAPRLKKFAIYRWDPDKPGDKPRMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNIAGGNTLACIKKIDSD
LNKVTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKEGKEQYLQSIEDRQKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAQLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKQKAAAA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcggtcggagtctccttgagacgcggagtccccggacggctcctgcgg
gccgggccgcgggcggtgctccgtgaggcgcagacggcggcggcggcgccgcggctgaag
aaattcgccatctacagatgggaccccgacaagcctggggacaaaccccgaatgcagacc
tacgaggtggacctgaacaagtgtgggcccatggtgctcgatgccctgatcaagatcaag
aacgaggtggactccacgctgaccttccgcaggtcctgcagggaggggatctgcggctcc
tgcgccatgaacatcgccgggggcaacaccctggcctgcatcaagaaaatcgacagcgac
ctcaacaaagtcaccaaaatctaccccctgccccacatgtacgtggtgaaggacctggtg
ccggacctgagtaacttctacgcccagtacaaatccatcgagccctacctgaagaagaag
gacgagtccaaggagggcaaggagcagtacctgcagtccatcgaggaccgacagaaactg
gacgggctctacgagtgcatcctgtgcgcctgctgcagcaccagctgtcccagctactgg
tggaacggtgacaagtacctgggccccgccgtgctcatgcaggcgtaccgctggatgatc
gactcccgcgatgacttcacggaggagcggctggcgcagctgcaggatccgttctcgctc
taccgctgccacaccatcatgaactgcacccgcacctgccccaaggggctgaaccccggc
aaagccatcgctgagatcaagaagatgatggcgacctacaagcagaaggcagcggctgcg
tga

DBGET integrated database retrieval system