KEGG   Cyanistes caeruleus (blue tit): 111938749
Entry
111938749         CDS       T05602                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111938749 (TGFA)
   04012 ErbB signaling pathway
    111938749 (TGFA)
SSDB
Motif
Pfam: EGF hEGF EGF_2
Other DBs
NCBI-GeneID: 111938749
NCBI-ProteinID: XP_023796434
LinkDB
Position
22
AA seq 127 aa
MDPHPSQRARVSLPAGVLLAACHALDNTTAARNAPVAAAVRSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGTLTCVCPQVSLGVRGDTLTCVCPQVSLGVRGDTDLCVSPGV
TRGTWGH
NT seq 384 nt   +upstreamnt  +downstreamnt
atggacccccacccatcccagcgggcccgtgtgtcgctccccgcaggtgtcctgctggcc
gcgtgccacgcgctggacaacaccacggccgcccgcaacgctccggtggcggcggcggtg
aggtcgcacttcaacgactgccccgactcccacagccagttctgcttccacggcacctgc
cgcttcctggtgcaggaggacaaacccgcctgcgtgtgtcactcggggtacgtggggaca
ctgacctgtgtgtgtccccaggtgtcactcggggtacgtggggacactctgacctgtgtg
tgtccccaggtgtcactcggggtacgtggggacactgacctgtgtgtgtccccaggtgtc
actcggggtacgtggggacactga

DBGET integrated database retrieval system