KEGG   Cyanistes caeruleus (blue tit): 111938902Help
Entry
111938902         CDS       T05602                                 

Gene name
GCK
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00052  Galactose metabolism
ccae00500  Starch and sucrose metabolism
ccae00520  Amino sugar and nucleotide sugar metabolism
ccae00524  Neomycin, kanamycin and gentamicin biosynthesis
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
ccae04910  Insulin signaling pathway
Module
ccae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111938902 (GCK)
   00052 Galactose metabolism
    111938902 (GCK)
   00500 Starch and sucrose metabolism
    111938902 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    111938902 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111938902 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111938902 (GCK)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     111938902 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111938902
NCBI-ProteinID: XP_023796621
LinkDB All DBs
Position
22
AA seq 465 aa AA seqDB search
MLDHRARMESSRKEKVEQILSEFHLKEEDLKKVMYRMQKEMDRGLKLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLKLVDENLLFNGEASEKLKTRGTFETRFMSQIESDSDDRKQIYNILSAFELLPS
RTDCEIVRRVCESVSTRAAQMCSAGLAGVINRMRESRSQDTLKITVGVDGSVYKLHPSFK
DHFHATVRQLTPGCDITFIQSEEGSGRGAALISAVACKMACMMGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcaccgagccaggatggagagcagcaggaaggagaaggtggagcagatcctg
tcggagtttcatctgaaggaggaggacctgaagaaggtgatgtaccggatgcagaaggag
atggaccgagggctcaaactggagacacatgaggaagcctctgtcaaaatgctgcccacc
tatgtccgttccacccctgagggctctgaggtgggagatttcctgtcactggacctgggt
ggcaccaatttccgtgtgatgctggtgaaggtgggcgagggggaggaggggcagtggaag
gtgaagacgaagcaccagatgtattccatcccagaggatgccatgaccgggacggctgag
atgctttttgactacatctccgagtgcatctctgatttcctggacaagcaccagatgaag
cacaaaaagctgcccctgggcttcaccttctccttccctgtgcggcacgaggatatcgac
aagggcatcctcctgaactggaccaagggcttcaaagcctccggcgcggaagggaacaac
gtggtggggctgctgagggacgccatcaaacggcgaggggacttcgagatggatgtggtg
gcaatggtgaatgacacagtggccacgatgatctcctgctactacgaagatcaccggtgc
gaggttgggatgattgtggggacgggctgtaatgcctgctacatggaggagatgcacaac
gtggagctggtggagggcgacgaggggcggatgtgtgtgaacacggagtggggagccttt
ggtgcctctggggagctggacgagttcctcctggagtacgaccgcgtggtggacgagacc
tcacttaaccccggtcagcaactgtacgagaagatcattggagggaagtacatgggggaa
atcgtgcggctggtgctgttgaagctggtggatgagaacctgcttttcaatggggaggcc
tctgagaagctcaagactcgtgggacttttgagacccgcttcatgtcccagattgagagt
gattctgatgaccgcaagcagatctacaacatcttgtcagcctttgagctgctgccatct
cggacagactgtgagatcgtgcgccgggtgtgtgagagcgtgtccacacgggctgcccag
atgtgttctgccgggctggccggtgtcatcaaccgcatgcgggagagccgcagccaggac
accctcaagatcactgttggtgtcgatggctccgtctacaagctccatcccagcttcaag
gaccacttccatgccacagtgcggcagctgacgcctggctgtgacatcacgttcatccag
tcagaggaaggcagcgggcgcggggccgctctcatctcagccgtggcctgcaagatggcc
tgcatgatggggcagtga

DBGET integrated database retrieval system