KEGG   Cyanistes caeruleus (blue tit): 111939944
Entry
111939944         CDS       T05602                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04068  FoxO signaling pathway
ccae04217  Necroptosis
ccae04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111939944 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111939944 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111939944 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccae03000]
    111939944 (STAT3)
Transcription factors [BR:ccae03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111939944 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 111939944
NCBI-ProteinID: XP_023798212
LinkDB
Position
27
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAENNAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctacagcagctcgacacgcggtacctggagcagctccaccag
ctctacagtgacagcttccccatggagctccggcagttcctggccccgtggattgaaagc
caggactgggcatatgctgccagcaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgctttctgcaggagtccaatgtcctgtaccag
cacaacctgcgccgcatcaagcagttcctgcagagcagatacttggagaagccaatggaa
atagcccgcatcgtggctcgctgcctctgggaagagtcccggctcctccagacagctgcc
actgctgcccagcaagggggacaggcaacacatccaacagcagctgtggtgacagagaag
cagcagatgctggagcagcacctgcaggatgtcaggaagagggtgcaggatctggagcag
aaaatgaaagtggtagaaaacctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggacctgaacgggaacaaccagtcagtgacccggcagaagatg
cagcagctggagcagatgctgacggcgctggaccagatgcgcaggggcatagtgagtgag
ctggctgggctgttgtcagccatggaatatgtgcagaagatgctggcagatgaggaactg
gcagactggaagaggcggcagcagattgcctgcattggtggcccacccaatatctgcctg
gaccggctcgagaactggataacctctctcgctgaatcacagctacagacccggcagcag
atcaagaagttggaagaactgcagcaaaaagtatcctataagggtgatccaatcgtccag
caccggcccatgctggaggagcggattgtggagctgttcaggaacctgatgaaaagtgct
tttgtcgtggagaggcagccctgcatgcccatgcaccctgaccgacccctcgtcatcaag
acaggagtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagttgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggggatgttgcagcacttcggggg
tcccggaagtttaatatcctggggaccaacaccaaggtcatgaacatggaggagtcgaac
aatggcagcctctcagcagagttcaaacacctgaccctgcgggagcagcggtgtgggaat
ggaggccgagccaactgtgatgcctcgctgatagtcaccgaggagctgcacctcatcact
tttgagacagaggtgtatcaccaggggctgaagattgacctggagacccactcattgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcactaagccgcccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacaaagcgcgggctc
agcattgagcagctgaccacgctggcagaaaaactgctgggaccaggtgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggacaacatcattgacttggtgaagaagtacatcctggcactgtgg
aatgaagggtacatcatggggttcatcagcaaggagagggagcgagccatcctgagcacc
aagcccccagggacctttctgctgcgcttcagtgagagcagcaaggaaggtggcatcacc
ttcacgtgggtggagaaggacatcagtgggaagacacagatccagtcggtggagccttac
accaagcagcagctgaacaacatgtcgtttgcggagatcatcatgggctacaaaatcatg
gatgccaccaacatcctggtgtccccgctggtgtacctgtacccagacatccccaaggag
gaggcgtttggaaagtactgccgctccgagagccaggagcactcggaggcaacggactca
ggtagtgctgctccgtacctgaagaccaagttcatctgtgtcacccccacttccttcagc
aacaccatcgacctgcccatgtccccgcgcaccctggactcactcatgcagttcggcaac
agcagcgagggagcagagaacaacgcgggtgggcagttcgagtcgctgaccttcgacatg
gagctgaccccagagtgtgcgtcctcgcccatgtga

DBGET integrated database retrieval system