KEGG   Cyanistes caeruleus (blue tit): 111940095Help
Entry
111940095         CDS       T05602                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04210  Apoptosis
ccae04625  C-type lectin receptor signaling pathway
ccae04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111940095 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111940095 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111940095 (MAP3K14)
   04672 Intestinal immune network for IgA production
    111940095 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111940095 (MAP3K14)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     111940095 (MAP3K14)
Protein kinases [BR:ccae01001]
 Serine/threonine kinases: STE group
  Other
   111940095 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 111940095
NCBI-ProteinID: XP_023798414
LinkDB All DBs
Position
27
AA seq 939 aa AA seqDB search
MAVMGIECQGAPDPAVKHKKELTAAKELKETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSSRSDSLDHIPNN
VAHATEGRMAPTWRGRHRGRAKKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQED
ESHQSTLYRNSFWVPEFNKDLGYDPLSFEKCAHAPLSTGKLHSPRSQYKTELHKLISPIQ
CLNHVWKQRDTVPQPETLHPFPYNILPPYFPLVDDPLHAMKHNALDTYFHGDLNYQDSRL
SGLNLEYNFTKYINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLEL
KEQFHEASENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCA
AKKVQVEHFRAEELTTCAAVTSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCL
PEDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLG
KCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLK
IAKEPPPLREIPPSCNPLTAEIIKLGLEKEPLHRASASELKTKTCVALEEVGGVRSPWKG
EYREPRHLSLNKENSAQTSLSPTVSPVSETGSDPKLSVKVSCASPVPPPPSLEQTEEVEG
SHWNEGKELPETWDPPPLSSTPLPLKSCSHMERATTISEQELQQLEIELFLNSLSQPYSL
EEQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQADGQSCSWNNLLSR
SRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQP
VRYDMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattgaatgccagggagctcctgatccagccgtcaagcacaaaaag
gagctcacagctgccaaggagctgaaggagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgcccacagtaaacgttacagcagccgctcggacagcctcgatcacatccccaacaat
gtggcccatgccacggagggcaggatggcgcccacctggcgagggaggcaccggggcagg
gccaagaagaaacggcacaagaaaagatccaagctgaaaggacaacctgtggctgctggc
aggagaagtccaagaactccagaacaggagagctgcactccaattcctgtccaggaggat
gaatcccaccaaagtactctttacagaaacagtttttgggttcctgaatttaacaaagac
ttgggctatgatccactgtcttttgagaagtgtgctcatgctcctttgtccacgggcaaa
ctccattccccaaggagccaatacaaaactgaactgcacaagctgatcagccctattcaa
tgccttaatcatgtttggaaacagagggacactgttccccagcctgagactctccatcct
tttccctacaacatccttcccccatatttcccacttgtggacgatcctctccatgccatg
aagcacaatgctctggacacatacttccatggtgacctcaactatcaagacagtcgctta
tctggcctaaacttagaatataatttcaccaaatacatcaaccagtccgtgcaaaccagt
tcagacaagctttctgtggaagaatatttggtagatgccttgaaggggagcgtgagtttt
ggtgaaccacaaaatttagccagcctggccaagacgtggagaggaggtgggctggagctg
aaggaacaattccatgaagcgagtgaaaatgaaggcgtgctgctgaacgagaagttgaag
ccagtggattacgagtaccgagaagaggttcactggacaaagtgccatggttccttgggc
attggctcttttggggaagtgtacaagatagaggacaagcagacaggatttcagtgtgct
gccaagaaggtgcaggtggaacacttccgtgccgaggagctgacgacgtgcgcggccgtg
acgagccccagtgtggtgcccctgtacggcgccgtcaaggagggcccctgggtcaccatc
ttcatgaagctgatggagggtggctcattagggcagctcattaaacagagtggctgcctg
ccagaggacagagccctcagctacctgggccaggtgttagagggtctggagtatcttcat
gctcaaaacattctccatggagatgtcaaagcggagaacgtgctgctgtcggacgatggg
agcagggccctcctgtgtgactttggccactctgctcacctgcacccagacgggctggga
aagtgcttggtcacagggaactacgtgcctggcacagagacccacatggccccggaggtg
gtgatggggaagcgctgtgactccaaggtggatgtgtggagcagctgctgtatgatgctg
cacatgctcaacggctgccacccctggacccagtactacaaccaccctctgtgcctgaag
atcgctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctcactgct
gagattattaagctggggctggagaaggagcctctgcacagggcatctgcatcagagctc
aaaactaagacctgtgtggcactcgaggaagtgggaggtgtgagaagcccctggaaaggt
gaatacagagagcccagacatttatctttgaacaaagaaaacagtgcacagacatccctg
tcccctacagtgagcccagtttctgagactggttctgacccaaaactgtcagtcaaagtt
tcctgtgccagcccagtcccaccacctccatctctggagcaaacagaggaggttgaggga
agccactggaatgagggcaaggagttacctgagacctgggaccccccacctctctcctcg
actcctctgcccctgaagagctgcagccacatggaaagagccacaaccatttcagagcaa
gaacttcagcagctggaaattgaactgtttctgaacagcctttcccagccttactctctg
gaagagcaagagcaaatgctttcatgcctcagcatcgacagcccctttgtgtcagatgcc
agtgagaagaactccatgaaggcttctcacagcttgagggacaccatgagctctgggatc
cattcctggaacagccaggcagacgggcagagctgcagctggaacaacctgctgagccgc
agccggcacacggacactcccagctacttcaacggagtgaaaatccagatccagttgcta
agtggagaaaatttgcacatcagagatttccacaggacaaaggtgggagacattgccaca
gggataagcagccagatccctgtgcctgccttcagcctggtgaccaaggaggggcagcct
gtgcgctatgacatggaggtgcccgactctggcatcgagctgcagtgcaccctggccccc
gactgcagcgtcagctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system