KEGG   Cyanistes caeruleus (blue tit): 111940103Help
Entry
111940103         CDS       T05602                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccae01002]
    111940103 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111940103 (ACE)
   04090 CD molecules [BR:ccae04090]
    111940103 (ACE)
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     111940103 (ACE)
Peptidases [BR:ccae01002]
 Metallo Peptidases
  Family M2
   111940103 (ACE)
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111940103 (ACE)
CD molecules [BR:ccae04090]
 Proteins
  111940103 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Ku_PK_bind Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 111940103
NCBI-ProteinID: XP_023798429
LinkDB All DBs
Position
27
AA seq 1277 aa AA seqDB search
MPAALGLLLGLSLAGALQPGLEPPQHEPTEEGATRFARDYNSTAELVLFESVSASWNYTT
NLTAENAALQVKASLEEQNFTELWGKKAKELYGDKWNNFSDPQLRKIIGSIQTLGPSNLP
LEMREQYNTILSDMDKIYSTAKVCLPNGTCWDLEPDLSDVMATSRSYKKLLYAWEGWHNA
AGNPLRPKYEEFVKLSNDAYKMDGFNDTGSYWRSWYDSDSFEKDLERIYTQLEPLYLNLH
AFVRRKLYDHYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPYPEKPNLDVTSSMVQQ
GWNATHMFRVSEEFFTSLGLLEMPTEFWKKSMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTSVTMEQLFTVHHEMGHIQYYLQYKDQPVSFRSGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSSAAEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPSRYNYDWWYL
RTKYQGICAPVPRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCKAANHNGSLH
TCDIYRSKEAGAKLREVLKAGSSKSWQDILLNLTGMGQMDAAPLLEYFSPVTKWLQEQNN
KTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNTTAEEVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDQSVTRILKKLSVIERAALPEN
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKMRNNYKRYVELSNKAAVLNGYKDNGAYWRSLYETSTFEEDLERLYLQLQPLYLNLHAY
VRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFDLVIPFPDATKVDATPAMKKQGW
TPKKMFEESDRFFTSLGLIPMPQEFWDKSMIEKPSDGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAVGDVMALSVSTPKHLHSI
NLLDQVMENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKDNEYNKEWWNLRM
KYQGLCPPALRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHKGPLHTC
DIYQSQEAGKILGDALKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLEKENEKN
GEVLGWPEYSWTPYTAQDDSSKTDFLGMFLTKSQATAGGWVLLALALIFLITTIFLGVKF
FSARRKAFKSSSEMELK
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggcgctggggctgctgctcgggctgagcctggcaggtgcccttcagcccggc
ctcgagcccccccagcatgagcccaccgaggaaggggccacccgcttcgccagagactac
aacagcacggccgagctcgtcctcttcgagagcgtctcggccagctggaattacaccacc
aacctgacggcggaaaatgctgctctgcaggtcaaggcatcactggaggagcagaacttc
acagagttatgggggaagaaagccaaggaactctatggtgacaagtggaataacttcagt
gacccccagctgaggaaaatcattggatccatccagaccttgggaccctccaacctgccc
ctggagatgagagagcagtataacaccatcctgagtgacatggacaaaatctactccacg
gccaaggtgtgcctgcccaatggcacctgctgggatctggagccagacctctcggacgtc
atggccacctctcgcagctacaagaagctgctgtacgcctgggaggggtggcacaacgct
gcggggaacccgctgcgccccaagtatgaggagttcgtgaagctgagcaatgacgcctat
aagatggatggattcaatgacacaggcagctactggcgctcctggtatgactcagactcc
tttgagaaggatctggagcgcatctacacccagctggagccactctacctcaacctgcat
gcctttgtccggaggaagctgtatgatcactatgggcccaaatacatcaacctgaagggt
cccatccctgctcacctcctggggaatatgtgggctcagcagtggaacaacatctatgac
ctgatgatcccctaccctgagaagcctaaccttgatgtcacgagcagcatggtgcagcag
ggttggaatgccacccacatgttccgagtctcagaggagttcttcacctccctggggctt
ctggagatgcccactgaattctggaagaagtccatgctggaaaagccgacagatgggcgg
gaggtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaag
caatgcacgtcagtgaccatggagcagctgttcacagtgcaccatgagatgggccacatc
cagtactacctgcaatacaaggaccagcccgtgtccttccgcagtggggccaatcctggc
ttccatgaggccatcggcgatgtcctgtccctctctgtctccactcccagccacctcaag
aaaattggcctcctcagcagtgctgctgaggatgaagagagcaatatcaactacctgctg
aagatggccctggagaagattgccttcctgccctttggctacctcatcgaccagtggcgc
tggaatgtgttcagtggccacacgccgccaagccgttacaactatgactggtggtatctg
agaaccaaataccagggtatctgtgctccagttccaaggaatgaaagcaactttgaccct
ggagcaaagtaccacatcccggggaacactccttacatcaggtactttgtgagcttcatc
ctccagttccagtttcacaaggcactgtgcaaggcagccaaccacaacggttccttgcac
acctgtgacatctacaggtccaaagaggctggagccaaactcagggaagtgttgaaagct
gggtcctcgaagtcatggcaggatatcctcttgaatctcactggcatgggtcagatggac
gctgctccccttctggagtatttcagccctgtcaccaaatggcttcaggagcagaacaac
aagaccaacgaggtcctgggctggcctgagtttgactggcgtccccctgtccctgaaggc
taccctgaaggcattgacaaaatagcagatgaggcacaagctaaagagttcttgtctgag
tacaacaccacagctgaggaagtgtggaatgcctacaccgaggcatcctgggcctacaac
accaacatcaccgaccacaacaaggagatcatgctggagaagaacttggccatgtccaag
cacaccctggagtacggcatgagggccaggcagtttgacacctcagatttccaggaccaa
agtgtcacccgcatcctcaagaagctgagtgtcattgagagggcagccctacctgagaat
gagctgaaggagtataacacccttctctcagatatggagaccacatacagcgtggccaag
gtctgcagagagaacaaaacctgtcacccattggatcctgacctcacagacatcatggcc
acctctcgggactatgatgagctcctctttgcctggaagggctggcgggatgcttctggg
aagaagatgaggaacaactacaagcgatacgtggaactgagcaacaaggcagccgtgctc
aatggctataaagacaacggggcctactggagatccctgtatgagacatccacctttgag
gaagatctggagaggctgtatctgcagctgcagcccctgtacctcaacctacatgcttat
gtacgccgagccctctacaaaaagtatggtgcagagcacataaacctgaagggtcccatc
cctgcccatctgctaggcaacatgtgggctcagtcatggtccaacattttcgacctggtg
atacctttcccagatgccaccaaggtggatgccaccccagccatgaaaaaacagggctgg
acaccaaaaaaaatgtttgaagagtcagaccgtttcttcacctctctgggcctcatcccc
atgccacaggagttctgggacaagtccatgatcgagaagccatcagatgggcgggaggtg
gtgtgtcatgcctcggcctgggatttctacaatcgcaaggatttcaggatcaagcagtgc
accgtggtgaacatggatgacctcatcacagttcatcacgagatgggccacgtgcagtac
ttcctgcagtacaaggaccagcctgtctccttccgtgatggggccaaccctggcttccat
gaggctgttggggatgtcatggccttgtctgtctccacccccaaacacctgcatagcatc
aatctgctggaccaagtcatggaaaatgaagaaagtgatattaactacctgatgagcatc
gccctggataaaatcgccttcctgccctttgggtacctcatggaccagtggcggtggaag
gtgtttgatgggcggatcaaggacaatgagtacaacaaggagtggtggaacctcaggatg
aagtaccagggcttgtgcccaccagcactgaggtctgaagatgactttgaccctggggca
aagtttcatatccctgccaacgtcccttacattaggtacttcgtcagctttgtgatccag
ttccagttccaccaggcactctgtgatgcagctgggcacaagggtcccctgcacacctgt
gacatctaccagtcccaggaggctgggaagatcttgggggatgccctgaagctgggtttc
agcaagccgtggcccgaagccatgcagctcatcacagggcagcccaacatgtcagcagag
gcccttatgagctacttcgagccactcatgacgtggctggagaaagagaacgagaagaac
ggggaggtcctgggctggcccgagtacagctggactccttacacagcccaagatgactcc
agcaaaactgatttcctgggaatgttcctgaccaaaagtcaagccacagcaggtggctgg
gtcctgctcgccctggcactcatcttcctgatcaccaccatcttcttgggtgtcaagttc
ttctcagccaggagaaaggccttcaaatccagctcagaaatggaactgaaataa

DBGET integrated database retrieval system