KEGG   Cyanistes caeruleus (blue tit): 111940397Help
Entry
111940397         CDS       T05602                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ccae  Cyanistes caeruleus (blue tit)
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccae01002]
    111940397 (TMPRSS9)
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     111940397 (TMPRSS9)
Peptidases [BR:ccae01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111940397 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 111940397
NCBI-ProteinID: XP_023798822
LinkDB All DBs
Position
28
AA seq 1100 aa AA seqDB search
MDQIKTGQGTQRRRLGACCWKVTAAAAVVGSATALCLGILLAACHSTGEASFEHTVELKG
ITFNSSLQMENSDYYRVLTPALERLFLSSLQDSQLNWSCTGCTILGYSRNGNSGVIVHFR
LLFAPQDSQPLSSILEEEALRHGLAAALHKQAFSLAAYGTISSASLTGPNKVSSHRPGLK
SDCGSRPAMQTASRIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEF
QDPAMWAAYTGTTSLRGSDSSTVKMDISQIIPHPSYNADTADYDVAVLELKRPVTFTKYI
QPVCLPDAGHHFPTSKKCLISGWGYLKEDFLVKPDFLQKATVELLDQNLCSSLYSHVLTD
RMMCAGYLEGKVDSCQGDSGGPLVCQEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTKLR
DWILDAISAFPTSIAHTVRPVHFRTNSNTVSAEEVNTTTGATPTTSPAPAASRPVTAARP
QECGGQPGFSTPSKIVGGTDASRGEIPWQVSLKEDSRHFCGATIIGDRWLLSAAHCFNET
MPEEIEAYVGTTSLNGTDENAVKVSVKRVVPHPLFNPMILDFDVAVLELARPLVFNKYIQ
PVCLPLAVQKFPVGKKCLISGWGDLQEGNDTKPEILQKASVGIIEQNTCNFLYNFSLTDR
MICAGFMEGMVDSCQGDSGGPLACEVTPGVFYLAGIVSWGFGCAQAMRPGVYSRITKFTD
WILDTISQLPSDGTSTPSSSAIPRTSATAIYIQPSTMAASPTSRTTLETKMNRTMNETST
ALRATETVKPTQTPVVPCTSLTFKCSSKVCIGKENPECDGVVDCSNGFDERNCDCGLTTA
LAFSKIVGGSSAAQGEWPWQVSLWLRRKEHKCGAVLIADRWLLSAAHCFDITLAGMICPT
GSTHSLSEKCPCSYSDPKMWVAFLGTPFLSGINGKMEKIFRIYKHPFYNVYSLDYDVALL
ELSTPVKFSSTIRPICLPDNSHIFHEGARCFITGWGSTKEGGLMSKHLQKAAVNMIGDQA
CKKFYPVQISSRMLCAGFPQGTVDSCSGDAGGPLACKEPSGKWFLAGITSWGYGCARPYF
PGVYTKVTAVQGWIVQNLKL
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggaccagataaagacagggcaaggcacccagagaaggagactgggggcctgctgctgg
aaggtaaccgctgctgctgctgtggtgggcagtgcaacagccctctgcctggggatcctg
ctcgcagcctgccattccacaggagaggccagctttgagcacacagtggagctgaaagga
atcacattcaacagcagcttacagatggagaactcggactactatagggtgctgacacct
gctcttgaaagactgtttctgtccagtctccaggactcccagctgaactggagttgcact
ggttgcactatcctgggctacagtaggaatggaaattccggtgtcatcgtccatttccgc
ctgctcttcgctccccaggattcccaacccttgagctctatcttggaggaggaagctctg
aggcatgggctggcagctgccctgcacaagcaggctttctccctggctgcctacgggacc
atctcctcagcttctctcacaggtcccaacaaggtttcttcgcacagacctggactgaaa
tcagactgtgggagtcgccctgccatgcagactgccagcaggatagttggaggctcagag
gcgtccagaggggagttcccgtggcaagtcagcctacgagagaacaatgagcacttctgc
ggggctgcaatcctcacagagaagtggctggtgtctgctgctcactgctttactgagttt
caggacccagccatgtgggcagcttacactgggaccacatccctcagaggctctgacagc
agtacagtgaaaatggacatttcacagatcatcccacacccctcttacaatgctgacaca
gctgactatgatgtggctgtgctggagctgaagagacctgtgactttcactaagtacata
cagcccgtgtgcctgccagatgctggccatcacttccccaccagcaagaagtgccttatt
tctggctggggctacctcaaggaggatttcttggtgaaacctgacttcctgcagaaagca
acagtggagcttctagaccagaacctatgttccagtctctacagccatgtcctcacagac
agaatgatgtgtgctggctacctggaggggaaagttgactcctgccagggtgactctggt
gggcccctggtttgccaagaaccatctggcagatttttcctggcgggaattgtgagttgg
ggtattggatgtgctgaagccaggcgccctggggtttacacacgtgttaccaaactcaga
gactggatcttggatgctatttctgccttccctacctccatagcccatactgttcgtcca
gtacacttcaggactaacagtaacacggtcagtgctgaagaggtcaacaccaccactgga
gcaactcccaccacctcaccagccccagctgccagcaggccagtgactgcagcaagacca
caagagtgtggaggacaacctgggttctctacacccagcaagattgtgggaggaacagat
gcttccagaggagagatcccttggcaagtcagcctgaaagaagactcaagacatttctgt
ggagccaccatcattggggaccgctggctgctgtcagcagctcactgcttcaatgagaca
atgccagaagagatcgaagcctatgtgggaacaacatccctaaatggaacagatgagaat
gcagtgaaagtcagtgtaaaaagagtggtcccacatcccctcttcaaccccatgattctg
gacttcgatgtggctgtacttgaactggcaagacctcttgtcttcaacaaatacatacag
ccagtgtgcctcccacttgctgtgcagaagtttcccgttggcaagaaatgcctcatttct
ggatggggtgacctgcaggaagggaacgacaccaagcccgagatcctgcagaaagcctct
gtgggcatcatagaacagaacacctgcaacttcctctacaacttctccctcactgaccga
atgatctgtgctggcttcatggaagggatggtagactcatgtcagggagattcaggtggg
cccttggcctgtgaggtgaccccgggagtgttttaccttgccggcatcgtgagctgggga
tttggttgtgcccaggctatgagacctggtgtgtactccagaattaccaaattcacagac
tggatcctggacaccatctcccagttgcccagtgatggcacaagcacaccttccagttca
gccatccctagaacttctgccacggccatttatatccagcccagcacaatggctgcaagt
ccaaccagcagaaccaccctggagacaaagatgaacagaaccatgaatgaaacttccaca
gctctgagagcaactgagactgtgaagcctacccaaaccccagtggtgccttgtaccagc
ctcactttcaagtgttccagcaaggtgtgtattggaaaagaaaatcctgaatgtgatggt
gttgtggactgcagcaatggtttcgatgagcgcaactgtgactgtggcctgacaactgct
ctggccttcagcaagattgtgggtggtagcagtgcagcccaaggagaatggccctggcaa
gtcagtctgtggcttcggcggaaggagcacaagtgtggggctgttctcattgctgaccgg
tggctgctctctgcagctcactgctttgacatcaccctggctgggatgatatgccccaca
ggaagcacacactccctatcagagaaatgcccctgcagttacagtgaccccaaaatgtgg
gtggcctttctaggaacacccttcctgagtggcatcaatggcaaaatggagaaaatattc
cgtatctacaaacatcctttttacaacgtctacagcctagactatgatgtggcactactg
gaactgagcacacctgtcaagttcagcagcaccatcagaccaatatgtctcccagacaat
tctcacatcttccatgaaggggccagatgcttcatcacaggctggggctccacaaaggaa
ggaggtctcatgtcaaagcatctgcaaaaagcggcagtgaacatgattggagaccaggct
tgcaaaaagttttaccctgtccagatcagcagcaggatgctgtgtgctggtttcccacag
ggcaccgtcgacagctgttcaggtgatgcaggtgggcccctggcatgtaaagaaccttca
gggaagtggtttctagcaggaatcacaagctggggctatggctgtgccaggccatacttt
cctggtgtctacaccaaagtcacagctgtccagggctggattgtacagaacctgaagctc
tga

DBGET integrated database retrieval system