KEGG   Cyanistes caeruleus (blue tit): 111940514Help
Entry
111940514         CDS       T05602                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00030  Pentose phosphate pathway
ccae00051  Fructose and mannose metabolism
ccae00052  Galactose metabolism
ccae01100  Metabolic pathways
ccae01200  Carbon metabolism
ccae01230  Biosynthesis of amino acids
ccae03018  RNA degradation
Module
ccae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111940514 (PFKM)
   00030 Pentose phosphate pathway
    111940514 (PFKM)
   00051 Fructose and mannose metabolism
    111940514 (PFKM)
   00052 Galactose metabolism
    111940514 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111940514 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccae01009]
    111940514 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ccae03019]
    111940514 (PFKM)
Enzymes [BR:ccae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111940514 (PFKM)
Protein phosphatases and associated proteins [BR:ccae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111940514 (PFKM)
Messenger RNA biogenesis [BR:ccae03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111940514 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 111940514
NCBI-ProteinID: XP_023799004
LinkDB All DBs
Position
LGE22C19W28
AA seq 796 aa AA seqDB search
MTALPVSPVLSPGLSRFLAPAALSLAALLLLLLLSFLPPAPSRRRSAGRKMPPSPEGSRH
TETLGVGKAIAVLTSGGDAQELRGSFAITVESSGDKIRGGDSKGTPDFRTREGRLRAARN
LAKRGITNLCVIGGDGSLTGADTFRAEWGGLLAELLKTGGITAEEAQRSSYLNIVGMVGS
IDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITALACG
ADWVFIPESPPKDDWEEHLCRRLAETRDGGSRLNIIIVAEGAIDKHGKPITSDDIKNLVV
KRLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVMALLEGTPDTPACVVSLSGNQAV
RLPLMECVQVTKDVTTAMNEGRFEDAVKLRGRSFQNNWNVYKLLAHIRPPATKSGYTVAV
MNVGAPAAGMNAAVRATVRIGLIHGHRMLAVHDGFEGLAFGMVEEIGWNAVGSWTGLGGS
KLGTKRTLPKKYFEEISANISKFGIHALIIIGGFEAFMGGMELVEGRARFEELCIPMCIV
PATVSNNVPGSDFSIGADTALNTITTTCDLIKQSAAGTKRRVFIIETMGGFCGYLATMAG
LAAGADAAYIFEEPFSSRDLQANVDHLTEKMKTTVKRGLVLRNERCNENYTTDFIYNLYS
EEGKGVFDCRKNVLGHMQQGGSPTPFDRNFGTKMGAKAVAWITGKIKECSRHGRIFANTA
DSACLLGMRKRSLVFQPIAELRQQTDFEHRIPKEQWWLRLRPILKILAKYNTELDTSETA
HLEHLTRKVLVPEAPL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgctcccggtgtctccggtgctgtctccggggctgagtcggttcctggccccg
gccgccctctccttggccgcgctcctcctcctcctcctcctgtctttcctcccccccgcc
ccgagccggcggcgctccgcaggcaggaaaatgcccccgagccctgagggatcccggcac
accgagaccctgggggtcggcaaagccatcgccgtcctcacctccgggggggacgcgcag
gagctccgggggagttttgcgataacagtggagagcagcggtgacaaaattcggggaggg
gactccaaggggacaccggatttccgcacgcgcgaggggcgactccgcgccgcgcggaat
ttggccaagcgtggcatcaccaacctgtgcgtgatcggcggcgacggcagcctcaccggc
gccgacaccttccgcgccgagtggggcgggctgctggcagagctgctcaaaacaggtggc
atcacggcagaggaggcgcagcgctcgagctatctgaacatcgtgggcatggtgggctct
atcgacaacgacttctgtggcactgacatgaccatcggcaccgactcagcactgcaccgc
atcatggagatcgtggatgccatcaccaccacagcgcagagccaccagaggactttcgtg
ctggaggtgatggggcggcactgtgggtacctggcactgatcacagccctggcctgcggc
gccgattgggttttcatccccgagtcaccccccaaggatgattgggaggagcacctgtgc
aggaggctggctgagacccgtgacggtggctccaggctcaacatcatcattgtggccgag
ggtgccatcgacaagcacggcaagcccatcacctcggacgacatcaagaatctggtggtg
aaacgtctggggtatgacaccagggtgaccatcctgggccacgtccagcgtggagggacc
ccctcagccttcgaccgcatcctggccagcaggatgggtgtggaggctgtgatggcgttg
ttggaggggacgccagacacaccagcctgcgtggtcagtctgtctggcaaccaggccgtg
cgtttgcccctcatggagtgcgtccaggtgaccaaggatgtcaccacggccatgaatgag
ggacgcttcgaggacgcggtgaagctgcggggccggagcttccagaacaactggaatgtc
tacaagttgctggctcacatccgcccacctgccaccaagagtgggtacacagtggccgtg
atgaacgtgggcgctccagctgcggggatgaatgcggctgtgcgggcaacagtgaggatt
ggcctcatccacggccaccgcatgctcgccgtgcacgacggcttcgaggggctggccttt
gggatggtggaggagattggctggaatgctgtgggcagctggacagggctggggggatcc
aaactgggcaccaagaggactctgcccaagaaatatttcgaggagatcagcgccaacatc
agcaagtttgggatccatgcactcataatcattggtggatttgaggcattcatgggtggc
atggagctggtggagggccgcgcacgcttcgaggagctctgcatccccatgtgcattgtc
cccgccaccgtctccaacaacgtccccggctctgacttcagcattggtgccgacaccgcc
ctcaacaccatcaccactacatgtgacctgattaagcagtcagccgcgggtaccaagcgc
cgtgtgttcatcatcgagaccatgggcggcttctgtggctacctggccaccatggccggg
ctggcggcaggcgccgacgctgcctacatctttgaggagcccttcagcagccgtgacctg
caggccaacgtggaccacctgacggagaagatgaagaccacggtgaagaggggacttgtg
ctcaggaacgagcgctgcaatgagaattacaccacagatttcatctacaacctctactcc
gaggagggcaaaggggtctttgactgccggaaaaatgtcctggggcacatgcagcaggga
ggcagccccactccatttgatcggaattttggcaccaagatgggcgccaaggccgtggcc
tggatcaccgggaagatcaaggagtgctctcggcatggccggatctttgccaacacggct
gactcggcgtgcctgctggggatgcgcaagcgtagcctggtgttccagcccatcgccgag
ctgcgccagcagacggattttgagcaccgcatccccaaggagcagtggtggttgaggctg
cggcccatcctcaaaatcctggccaagtacaacactgagctggacacgtcagagacggca
cacctggagcacctgacccgcaaggtcctggtccccgaggcccctctgtga

DBGET integrated database retrieval system