KEGG   Cyanistes caeruleus (blue tit): 111941464Help
Entry
111941464         CDS       T05602                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2 isoform X1
  KO
K06481  integrin alpha 2
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04145  Phagosome
ccae04510  Focal adhesion
ccae04512  ECM-receptor interaction
ccae04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    111941464 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111941464 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111941464 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111941464 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111941464 (ITGA2)
   04515 Cell adhesion molecules [BR:ccae04515]
    111941464 (ITGA2)
   04090 CD molecules [BR:ccae04090]
    111941464 (ITGA2)
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111941464 (ITGA2)
  Exosomal proteins of bladder cancer cells
   111941464 (ITGA2)
Cell adhesion molecules [BR:ccae04515]
 Integrins
  Integrin alpha subunits
   111941464 (ITGA2)
CD molecules [BR:ccae04090]
 Proteins
  111941464 (ITGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA VWA_2 FG-GAP VCBS FG-GAP_2 Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 111941464
NCBI-ProteinID: XP_023800360
LinkDB All DBs
Position
Z
AA seq 1204 aa AA seqDB search
MCQRLYLFSSLGGAVTDEEPFSLGSKFFFNCFLIIMIFLLTGILHNCCEAYNVGLLKAKI
FSGPPREQFGYAVQQFINEQGKWLLVGSPWSGYPANRTGDIYACPVGVSKNTCKKLNLQA
LINIPNVTEIKEDMNLGLTLIQNSKTGGFLTCGPLWAQQCGRQYYATGVCSEISPSFEIL
RSFSPAVQKCSSVIDVVVVCDESNSIYPWDAVRAFLKKFVQGLDIGLNKTQVGLIQYAND
PRVVFNLNTYQTKDEVVRAMENTSQKGGDLTNTFKAIDNARQYAFSAEAGGRPTATKVMV
VVTDGESHDGSNLKTVIGKCNEDNITRFGIAVLGYLIRHELDTKNLIKEIKGIASHPTEK
YFFNVSSEAALLEEAGTLGERIFSIEGTDQGDTFQMEMSQVGFSASYSQKKDVLLLGAVG
AYDWSGTVVQESSDRVTTFPSHVFEKILQDRNHSSYLGYSVAVLSTMSSVYFVAGAPRSN
YTGRVVVYDVDSDGNIAIVQSQRGEQIGSYFGSVVCSVDVNRDSVTDVLLVGAPMFMNDL
KKEEGRVYMFSITKRILDQQELLEGPQGSENARFGSAIAALADIDLDGFNDVVIGAPLEN
QNSGAIYIYNGFQKTIRTKYSQKILGSDSAFGQKLQFFGRSVDGHRDLDDDGITDVSVGA
DGNVVVLWSRGIANVSIIASFKPEKISLVNKNTDITVKICFQATFRPAKKNNQVDIKYNA
TLDADLQFSRVTSRGFFKENNERYMQRDLVVHQEENCVHDVFSVQEPSDAVNSLSLRIDI
GLANPGSGPVLDISSPASVAYSIPFIKDCGEDELCICDLALNVQWKADDGKQQFIVSSKT
RRLTFNVKLRNKKENAYNTRIQATFSDNLFFASSSLPSDGTEVSCQTGTAQSTVICQISY
PVFRTGQQVSFDISFDFNLKNLQNVAVLSFHAWSESKEQQESDNQVTLSIPLRYDAEIHF
TRLANINFYEVYSGHNIPSTVNNFEDIGPTFNFSVKVTTGSIPVKVASVTINLPALTSKG
NPLMYLTAVTTDEAKGVTCDAQINPLQIGKRPYSPSFIKENFRTSKELTCKNVKCSTITC
KLEDITLKGEYFVNVSTQIWNGTFASLIFQTLQLSAEAKIDTHNPDLFIIGENTLTIPVT
IMKPDEKAEVPVGVVIGSILAGLLLLLVLVAVLWKLGFFKRQYEKMTQDIEDVDEIAELT
KDKD
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaaaggctgtatttattttcttctcttgggggagctgtcacagatgaagagcct
ttttcactgggatcaaaattcttctttaattgcttcttgataatcatgatctttctgtta
acaggcattcttcacaactgctgtgaagcctacaatgttgggctcctgaaagcaaaaata
ttttctggtccaccaagagagcagtttggatatgcagttcaacagtttataaatgaacaa
ggcaaatggttgttggttggttcaccctggagtggctatcctgctaacagaactggagat
atatatgcatgtcctgttggtgtgtcgaaaaacacatgtaaaaaattgaatttacaagct
ttaataaatattccaaatgtgactgaaattaaagaggacatgaaccttggcttgactctg
atacagaactcaaaaactggaggatttttgacttgtggtcccttgtgggcacagcagtgt
ggaagacaatactatgcaacaggagtttgttctgaaatcagtccaagtttcgagatctta
agaagcttttctcctgctgttcaaaagtgttcatctgttatagatgttgtggtggtttgt
gatgagtcaaacagcatttatccctgggatgcagtgcgggcatttttgaaaaaatttgta
caaggcttagacataggccttaacaaaacccaggtgggtttaattcagtacgctaatgat
ccccgcgtagtcttcaacttgaatacgtatcaaacaaaggatgaggtcgttagagcaatg
gagaatacgtctcagaagggaggagatctcactaatactttcaaagccattgacaatgca
agacagtatgccttctcagctgaagcaggaggacgcccaacagccacaaaagtcatggtt
gttgtgacagacggtgaatcacacgatggctccaacttgaaaacagtgataggtaaatgc
aatgaagacaatataaccagatttggcattgctgttttgggatacttaataaggcatgaa
cttgatactaaaaacttaattaaagaaatcaaggggattgctagtcacccaacagaaaag
tatttcttcaatgtgtcatctgaggctgcactactggaagaagcaggaacgcttggagag
cgcatttttagtatagaaggtactgatcaaggtgatactttccaaatggaaatgtcacag
gtgggcttcagtgcatcttattcacaaaaaaaggatgttctgctgctgggtgcagttggg
gcctatgactggagtggaacagtagttcaggaatcttcagacagagtcaccacctttcca
agccatgtgtttgagaagattttacaggacagaaaccatagctcctatctaggttattct
gttgctgttctctcaactatgagctctgtctattttgttgctggtgcaccaagatccaac
tatactggcagagtggtggtttatgatgttgatagtgatggtaacattgcaattgtgcag
tcacagagaggggagcagattggctcctactttggcagtgtggtatgttcagtggatgtc
aacagggattctgtgacagatgtgctgcttgtgggtgcaccaatgtttatgaacgacctg
aagaaagaagaagggagagtatatatgttttccatcacaaagagaatcttggatcaacaa
gaactcttggaaggtccacaggggtcagaaaatgcacgctttggatcagcaattgcagca
cttgcagacattgatttggatggctttaatgatgttgtaataggtgcaccactggaaaac
caaaactctggagcaatttacatatataatggatttcaaaagactatacgtaccaaatat
tctcagaaaatcttaggatcggattctgcttttggacaaaagctccaattctttggaaga
tcagtagatggccatagagacttagatgacgatggcattactgacgtatcagttggtgct
gatggaaatgtggttgtgctatggtcaagaggcattgcaaatgtgtccataattgcttca
tttaaacctgagaaaatcagtctggtgaacaagaatacagatataactgtcaaaatatgc
tttcaggctacatttagacctgctaagaaaaataatcaagtggatataaagtacaatgca
acattggatgcagacctgcagttctccagagtgacttctagaggatttttcaaagaaaat
aatgaaaggtacatgcagagggatcttgtggtgcatcaagaagagaattgtgttcatgat
gtcttcagtgtacaagagccttcagatgcagtgaattcacttagtttgcgcattgacatc
ggccttgcaaaccctggctccggccctgtcctggacatatcttctccagcatctgtggcc
tatagcattccttttattaaagactgtggtgaagatgaactttgtatttgtgatcttgct
ctgaatgttcagtggaaggcagatgatggcaaacaacagtttattgtcagcagcaaaacc
agaagactaacgttcaatgtgaaattgagaaataaaaaggaaaatgcatataacaccaga
atccaggcaacattttcagacaacctgttttttgcttcatcttctttaccgagtgatggg
actgaagtctcgtgtcaaacaggaacagcgcaaagtacagtcatttgccaaataagctat
cctgttttcagaacaggacaacaggtatcctttgatattagctttgattttaaccttaaa
aatcttcagaatgtggcagttctaagttttcatgcatggagtgaaagtaaggaacagcaa
gagtcggacaaccaggtcaccttatcaattcctctgcgatacgatgcagaaattcacttc
acaaggcttgccaacatcaacttttatgaagtatactctggtcataacattccttccact
gtgaataattttgaagatattggccccacgttcaacttctcagttaaggtaacaacagga
agtattccagtaaaggtggcatctgtaacaatcaatcttccagcactgaccagcaaaggc
aacccactaatgtacctaactgcagtcaccacagatgaggccaaaggtgttacttgtgac
gctcagataaatccactgcaaattgggaaaagaccttattctccatctttcataaaagag
aacttcagaacttccaaagaactgacctgtaagaacgtgaagtgcagtaccatcacatgc
aaactggaagatattacactgaagggagagtactttgtgaacgtgtccacccaaatctgg
aatggaacctttgcttccttaattttccagacattacaactctctgcagaagcaaaaatt
gatacacataaccctgatttatttataattggagagaataccctaactatcccagttaca
ataatgaagccggatgagaaggctgaggtgccagtaggtgttgtgattggcagcatattg
gctggactcctcttgctgttggtactggttgctgttttgtggaaacttggcttcttcaag
agacagtacgagaaaatgacacaggatatagaagatgttgatgaaattgcagaactcaca
aaggacaaagactga

DBGET integrated database retrieval system