KEGG   Cyanistes caeruleus (blue tit): 111942179
Entry
111942179         CDS       T05602                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04010  MAPK signaling pathway
ccae04210  Apoptosis
ccae04620  Toll-like receptor signaling pathway
ccae04621  NOD-like receptor signaling pathway
ccae04622  RIG-I-like receptor signaling pathway
ccae04623  Cytosolic DNA-sensing pathway
ccae04625  C-type lectin receptor signaling pathway
ccae04920  Adipocytokine signaling pathway
ccae05132  Salmonella infection
ccae05164  Influenza A
ccae05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111942179 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111942179 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111942179 (IKBKG)
   04621 NOD-like receptor signaling pathway
    111942179 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    111942179 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    111942179 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    111942179 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111942179 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111942179 (IKBKG)
  09172 Infectious disease: viral
   05164 Influenza A
    111942179 (IKBKG)
   05168 Herpes simplex virus 1 infection
    111942179 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccae01001]
    111942179 (IKBKG)
Protein kinases [BR:ccae01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111942179 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 TPD52
Other DBs
NCBI-GeneID: 111942179
NCBI-ProteinID: XP_023801125
LinkDB
Position
Unknown
AA seq 327 aa
MSPTHSDPPDSPSCPPSSEEQLKQRLAEAEAELVTLRARVAVAELRAQDVSRAAELQLQG
LRRQLEQDKAQVQAQVTSLLGELRESQNRLERSRAEREHLERRARSDAERCQQLEEVTQG
HQVQLDQLRLQVTNLETALRVERRGATEEKRKLVQLQAAYHHLFQEYDAHIKASLEGDKR
SQVTQEQLRAAEAALALKQDLIDHLKAEAERQRAALETIPVLQAQADIYRADFEAERAAR
EQLHGQREALQEELNQLRLRLGGDGARARLEEMRNRHSEPPPAPVPGRGFGGLLPLAEEG
PDLCCPKCQYKAPDMDTLQIHVMDCIK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtccccaacccactctgacccccctgactccccctcgtgtccccccagttctgaggag
cagctgaagcagcgcctggcagaggctgaggctgagctggtgacactgcgggcacgtgtg
gccgtggccgagctccgggctcaggatgtttcccgcgcagctgagctgcagctgcagggc
ctgcgccgccagcttgagcaggacaaggctcaggtgcaggcccaggtgacatcgctgctg
ggggagctccgagagagccaaaatcgcctggagcgtagccgggcagagcgggagcacctg
gagcgcagggcccgcagtgatgccgagcggtgccagcagctggaagaggtgacccagggc
caccaggtgcagctagatcagcttcggctccaggtgaccaacctggaaactgccctgagg
gtggagcggcgtggggccaccgaggagaagcggaagctggtgcagctgcaggccgcatac
catcacctgttccaggagtatgacgcccacatcaaggccagcctggagggggacaaacgg
agccaggtgacgcaggagcagctccgggcggccgaggccgcactggccctcaagcaggac
ctgatcgatcacctcaaagccgaggccgagcgccagcgggcggccttggagaccatcccg
gtgctgcaggcccaggccgacatctatagggcggattttgaggcggagcgcgcggcgcgg
gagcagctgcatgggcagagggaggcactgcaggaggagctgaaccagctgcggctgcgc
cttggcggggatggggcccgggcccgtctggaggagatgcggaaccggcactcagagccg
cccccggcaccggtcccaggaaggggttttggggggctcctgccccttgctgaggaaggg
cccgacctgtgctgccccaagtgccagtacaaggctccggacatggacacactgcagatc
catgtcatggattgcatcaagtga

DBGET integrated database retrieval system