KEGG   Cyanistes caeruleus (blue tit): 111943003Help
Entry
111943003         CDS       T05602                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04080  Neuroactive ligand-receptor interaction
ccae05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111943003
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    111943003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccae01002]
    111943003
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccae04147]
    111943003
Enzymes [BR:ccae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111943003
Peptidases [BR:ccae01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111943003
Exosome [BR:ccae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111943003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 111943003
NCBI-ProteinID: XP_023801829
LinkDB All DBs
Position
1
AA seq 500 aa AA seqDB search
MKCLLLLAFIGVAVAFPAFAEDDDDKIVGGYTCAEHSVPYQVSLNSGYHFCGGSLISSQW
VLSAAHCYKYRIQVQLGKHNLKLNESTQQFINSAKVIRHPGFNAQNADSDIMLIKLATPA
QLNKAVQTVPLPTSCVATGTTCLISGWGNILSNGIEYPDELQCLDAPVLSATECSDAYPG
QISGNMMCVGFLEGGKDSCQEDSGGPVVCNGEIQGIVSWGIGCAEKGHPGVYTKVCNYIS
WIRSTMASNTMKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCAEHSVPYQVSLNTIGYH
FCGGSLISSQWVLSAAHCYKSRIQVQLGKHNLKLNESTQQFINSAKVILHPGFDYYTLDN
DIMLIKLATPAQLNNAVQTVPLPTSCVATGTTCLISGWGNTLSDGIHDPDELQCLDAPVL
SAAECSDAYPGQITENMMCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGIGCAEKGYP
GVYTKVCNYVSWIQSTMASN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttctcgcctttattggggtggctgttgccttccccgcctttgct
gaagatgatgatgacaagattgtgggaggctacacctgtgcagaacactctgtgccctat
caggtgtctctgaattctggatatcacttctgtggaggttccctcatcagcagccagtgg
gtcctgtcggctgctcactgctacaaatatcgcatccaagtgcagctggggaaacacaac
ttgaaactcaatgaatccactcagcagttcatcaactctgctaaagtcatccgccaccct
ggcttcaatgcccaaaatgcagatagtgacatcatgctcatcaagctggccaccccagcc
cagctcaacaaagctgtccaaaccgttcctctgcctaccagctgcgtggccaccggcacc
acctgcctgatctccggctggggcaacattctcagcaatggcattgagtacccggacgaa
ttgcagtgcctggacgctccggtcctctctgccaccgagtgctccgatgcctaccccggg
caaatctctgggaacatgatgtgtgtaggattcctggagggaggaaaagactcctgccag
gaagattccggcggtcccgtggtctgcaatggagagatccagggcattgtttcctggggt
attggatgtgctgagaagggccatcccggagtttacaccaaggtttgcaactacatctcc
tggatccgatccaccatggcctccaacaccatgaagtgcctgctgcttctcgcctttatt
ggggtggctgttgccttccccacctttgctgaagatgatgatgacaagattgtgggaggc
tacacctgtgcagaacactctgtgccctatcaggtgtctctgaatactattggatatcac
ttctgtggaggttccctcatcagcagccagtgggtcctgtcggctgctcactgctacaaa
tctcgcatccaagtgcagctggggaaacacaacttgaaactcaatgaatccactcagcag
ttcatcaactctgctaaagtcatcctccaccctggcttcgactactacactctggacaat
gacatcatgctcatcaagctggccaccccagcccagctcaacaacgctgtccaaacagtt
cctctgcctaccagctgcgtggccaccggcaccacctgcctgatttccggctggggcaac
actctcagtgatggcattcacgacccggacgaattgcagtgcctggacgctccggtcctc
tctgctgccgagtgctccgatgcctaccccgggcaaatcactgagaacatgatgtgtgta
ggattcctggagggaggaaaagactcctgccagggagattccggcggtcccgtggtctgc
aatggagagctccagggcattgtttcctggggtattggatgtgctgagaagggctatccc
ggagtttacaccaaggtttgcaactacgtctcctggatccaatccaccatggcctccaac
tga

DBGET integrated database retrieval system