KEGG   Cyanistes caeruleus (blue tit): 111944648
Entry
111944648         CDS       T05602                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04012  ErbB signaling pathway
ccae04068  FoxO signaling pathway
ccae04110  Cell cycle
ccae04115  p53 signaling pathway
ccae04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111944648 (CDKN1A)
   04068 FoxO signaling pathway
    111944648 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111944648 (CDKN1A)
   04115 p53 signaling pathway
    111944648 (CDKN1A)
   04218 Cellular senescence
    111944648 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111944648
NCBI-ProteinID: XP_023803125
LinkDB
Position
Unknown
AA seq 151 aa
MPLSQSRAGQTPCSSKVCRNLFGPVDHEQLQHDFEDKIRQQLEEAQQRWNFDFETETPLE
GPFKWERILVAEQPPQGVHSLVRAVTSSDNRSSLAHRVPPKDHVGRICPEESQQSSKAYK
AGSSQSLKRGQTTIKDFYSAKRRIVPARPRP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgctgtcccagagcagggctgggcagaccccatgcagcagcaaggtgtgcaggaac
ctctttggccctgtggaccacgagcagctccagcatgactttgaggacaagataagacag
cagctggaagaagctcagcagcgctggaacttcgactttgagacggagactcccttggaa
gggccgttcaagtgggagaggatcctcgtggctgagcagccgccccagggggttcacagc
ctggtcagggctgtcaccagcagtgacaacaggagctccttggcccacagggtccccccc
aaggaccatgttggcaggatttgccctgaggagtctcaacagagctcgaaggcttacaag
gctggttcctcgcagagtttgaaacgtgggcagaccacgatcaaagacttctacagtgcc
aagcggaggatcgtccctgcgcggccccggccgtga

DBGET integrated database retrieval system