KEGG   Cyanistes caeruleus (blue tit): 111945023Help
Entry
111945023         CDS       T05602                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111945023
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111945023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111945023
NCBI-ProteinID: XP_023803486
LinkDB All DBs
Position
Unknown
AA seq 140 aa AA seqDB search
SPCGDKSSPLKGTGPVKVTGKITGLADGEHGFHVHEFGDNTNGCTSAGPHFNPEQKKHGA
PSDAERHVGDLGNVTAKGGVAEVEIQDSVISLSGPHSIIGRTMVVHEKRDDLGRGGDNES
TVTGNAGPRLACGVIGIAKS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
agtccttgcggtgataaatcctctcctttgaagggtaccggaccggtgaaagtcactggg
aaaatcactggattggccgatggagagcacggcttccacgtccatgagttcggtgacaac
accaatggctgcaccagtgctggcccccacttcaacccagagcagaagaagcacggggct
cccagcgatgccgagaggcacgtgggagacctgggcaatgtgactgccaaaggaggcgtg
gccgaggtggagatccaggattccgtcatttccctctccggaccacacagcatcatcggc
cgcaccatggtggtgcatgagaagcgggatgacctgggcagagggggagataacgagagc
acagtgactggaaacgcaggcccccgcctggcctgcggagtgattggcattgccaagagc
taa

DBGET integrated database retrieval system