KEGG   Cyanistes caeruleus (blue tit): 111945440Help
Entry
111945440         CDS       T05602                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells-like
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    111945440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccae03400]
    111945440
DNA repair and recombination proteins [BR:ccae03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     111945440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 111945440
NCBI-ProteinID: XP_023803857
LinkDB All DBs
Position
1
AA seq 1194 aa AA seqDB search
MGVQGLWKLLECTGRPINPETLEGKILAVDISIWLNQAIKGARDRGGISVRNAHLLTLFH
RLCKLLFFRIRPVFVFDGEAPLLKRQTLAKRRQRKEIAINDSRKTTEKLLKTLLKRHVIK
TALTGKSNEALPSITQARRERVDDMYVLPALEDEEKNSSEEEEEKEWQMRMNQRKMLQEQ
LCENPYSVDIESEDFHKLPPEIKHEILTDIKELTKRRRTLFEAMPEDSNDFSQYQLRGLL
KKSNLNRCIENVQKEMNQQHSGEIQTQYENEGGFVKEVESRRVVSEETSHYILIKGIQAK
EAMSRDLEATAGPSSKMHDLTKLNKISESPANAKLPASDKKQTEEADNVVAAPPSPRTLL
AIRAAMVESSSEEELDAGQLNVDQFVSEEGSVSPRTLRAIQQALSEDDNGEEVVTATTDG
VLSERPEKKDFLLNSSDEEEQIPDVKEGTNIPTAAIHSSIQVTMQDAEFKQKGQELEKNH
ITLKDTGVFRNENYSAIENIRKGKEDIDKEENYSENHIAPKDISIARAETYIDCTIKDKE
DVDKEENGSKNHISPNDTSISRAENYSYNNNTRNDKEDLDKEKNGSKMDIKSLGDKDMNL
CLQKPRCSPVQTGIDALSRAETTDLSKNEENVKISENTQEVISQTEENISGVTRVFPGAR
DPKEEREGISQSEDSDSDGSFIEVDAEVSNEAEFPTKYDEKMGDEPTLPEVETDRPDVFT
LDLLKESDEVQLGNTQNAEKEADDKSAVDEWQDISLEELEELEKDLSAEQNMLQSQKQQQ
ERVAASVTGQMFLESQELLRLFGIPYIEAPMEAEAQCAILDLTDQTSGTITDDSDVWLFG
ARHVYKNFFSHNKYVEYYQYVDFQNELGLDRSKLINLAYLLGSDYTEGIPNVGFVTAMEI
LNEFPGHGLEPLVKFAEWWNEAQKNKKARPNPHDTKVKKKLRELQLYSGFPNPAVAEAYL
KPVVDESRGSFTWGKPNVEQIREFCKDHFGWTRTKIDGILLPVMKQLNSQQTQLRIDSFF
RLEQHEKQAIKSQRLRRAVTCLKRKEKEADDEIQEATAVMELELKQPGKKTGEGTTGGAN
QAAATKVQSGKRRKHSDSRKEFLYGGGFVGNLHLSETSSDSSVEESKGRGLGKSKRRKNM
SATETADHKEKKGCSSSSGEDEDLGNVVMVTAKPVFEGRKKKSRSKRGMRKKMS
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcaaggactttggaagctgcttgaatgcaccgggagacccataaacccggaa
acgctggaagggaaaattcttgctgttgatatcagtatttggttgaaccaagcaataaag
ggagccagagatcgtggtggtatttctgtacggaatgctcacctgctcactctgtttcat
cgactctgcaagttactgttttttcggattcgacctgtctttgtttttgatggagaggca
cctcttctgaagagacaaaccttggctaagcgaagacaaagaaaggaaattgctatcaat
gattccaggaaaactacagagaaactcttgaaaacacttttgaagagacatgttatcaaa
actgctcttacaggcaaaagcaatgaagctttgcccagtattacacaagctcgaagagaa
agagttgatgatatgtatgtattgcctgctttagaggatgaagagaagaatagctcagag
gaggaggaagaaaaagaatggcaaatgagaatgaaccaaagaaagatgttgcaagaacag
ttatgtgaaaatccgtattctgtagatattgaatcagaagatttccacaagctgcctcca
gaaataaaacatgagatcttgactgatattaaagaacttacaaagcgaagaagaacatta
tttgaagcaatgccagaggactccaatgacttttcccagtaccagcttaggggtttgctt
aaaaaaagcaacctcaatcggtgcatagaaaatgtacaaaaagaaatgaatcaacaacac
tcgggtgaaatccaaacacaatatgaaaatgaaggtggttttgtgaaagaagtggaatca
aggagggtggtctctgaagagacttctcactatattctgataaagggtattcaagcaaaa
gaagctatgagtagagacttggaagctactgcaggaccctcatcaaaaatgcatgatttg
actaaattaaataaaatcagtgaatctcctgctaatgcaaagctgcctgcatcggacaag
aagcagacagaggaagctgacaatgtggtggcagcacccccctctcctcggactttgctt
gctatccgggcagccatggtggaaagcagctcagaagaagaactggatgcaggacaattg
aacgtggaccaatttgtgtcagaggaaggcagtgtatctccaagaacactgcgggcaatt
cagcaagctctgagtgaagatgataatggggaggaagttgttactgctacaactgatgga
gtgctgtcagaaagaccagaaaaaaaggattttctgcttaatagctcagatgaggaagag
cagattcctgacgttaaggagggaacaaacattcctacagctgcaattcattcatcaatc
caagtgactatgcaagatgctgaatttaaacaaaagggtcaggagttagaaaaaaatcat
attacactcaaggacactggtgtattcagaaatgaaaattactctgctattgaaaatatt
agaaaaggcaaagaagatatagacaaggaagaaaattattcggaaaatcatattgcaccc
aaggacatcagtatagccagagctgaaacttatattgactgtactataaaagacaaagaa
gatgtagacaaggaagaaaatggttccaaaaatcatatttcaccaaatgataccagtata
tccagagctgaaaattattcttataataacaatactagaaacgacaaagaagacttagac
aaggaaaaaaatggttccaaaatggacataaagtctctgggagataaggatatgaatttg
tgtttgcagaagccacgttgttcccctgtgcaaactggtatagatgctttgagtcgtgct
gaaacaacagacctttctaaaaatgaggaaaacgtgaaaatttctgaaaatacccaggaa
gtaatttcacaaacagaggagaatatatctggggttactagagtttttccaggagcaaga
gatcctaaggaggaaagagaaggcatatcacagtccgaagatagtgattctgatggaagc
tttattgaggtggatgctgaggtcagtaatgaggctgagtttcctactaaatatgatgaa
aaaatgggtgacgaaccaacacttccagaggtggagacagacagacctgatgttttcaca
ctggacttgctgaaggagtctgatgaagtgcagttgggaaacactcagaatgctgaaaaa
gaagctgatgataaaagtgcagtggatgagtggcaagacatcagtttggaagaactagaa
gaattagaaaaggacctttctgctgagcagaatatgcttcagtctcaaaaacagcagcag
gaacgtgttgctgcttctgtaacaggacagatgttcttggaaagccaggagctcctccgt
ctgtttggcattccatatatcgaagctccgatggaggcagaggcacagtgtgccatattg
gaccttactgatcagacctctgggacaatcactgatgacagtgatgtttggttgtttggt
gcacgacatgtttataaaaatttcttcagtcataacaaatacgtagaatattatcagtat
gttgactttcagaatgagctaggattggatagaagcaagctaattaatttggcatacttg
cttggaagtgactacactgagggcatcccaaatgttggctttgtaacagcgatggagatt
ttaaatgaatttcctgggcatggcttggaacctctcgtaaaatttgctgagtggtggaat
gaggctcagaagaataagaaagcgaggcctaatccacatgacaccaaagtcaagaagaaa
ctgcgggagctacagctttattcaggtttcccaaatccagcagtggcagaagcatacctg
aagcctgtggtggatgagtcaaggggttcgttcacctggggaaagcccaatgtagagcag
atcagagaattctgcaaggatcactttggctggactaggacgaagatagatggaatcctt
ttgcctgtgatgaaacagctgaactcgcagcagactcagcttcgaatagattcattcttc
agactagaacagcacgagaaacaagctattaaaagtcagagactgcgcagagctgtgact
tgtctgaagagaaaggaaaaggaagcggacgatgaaattcaggaggcaacagctgtcatg
gagctggaacttaaacagcctgggaaaaagacaggggaaggtaccacaggtggtgcaaat
caagctgcagcaacaaaagtacagagtggaaagagaagaaaacattcagattccagaaaa
gaatttttatatggaggtggttttgttggaaatttgcatctttcagaaacttctagtgac
tcctcagtggaggaatccaaaggcagaggtttaggcaagagcaaaaggaggaaaaacatg
tctgcaacagagacagcagaccataaagagaaaaaagggtgcagtagctcaagtggtgag
gatgaagacctgggaaatgtagtcatggtgactgccaaacctgtgtttgaaggcagaaaa
aagaaatcacggagcaagagaggaatgagaaagaaaatgtcttaa

DBGET integrated database retrieval system